Comparison

Recombinant Rat Urokinase plasminogen activator surface receptor(Plaur),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 500ug
Host E.coli
Item no. CSB-EP018122RA-500
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
CD87
AA Sequence
LRCIQCESNQDCLVEECALGQDLCRTTVLREWEDA EELEVVTRGCAHKEKTNRTMSYRMGSVIVSLTETV CATNLCNRPRPGARGRPFPRGRYLECASCTSLDQS CERGREQSLQCRYPTEHCIEVVTLQSTERSVKDEP YTKGCGSLPGCPGTAGFHSNQTFHFLKCCNFTQCN GGP
Research Topic
Others
Uniprot ID
P49616
Gene Names
Plaur
Tag Info
N-terminal 6xHis-tagged
Expression Region
1-178aa
MW of Fusion Proten
23, 9
Sequence Info
Partial
Relevance
Acts as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA.
Reference
The receptor for the plasminogen activator of urokinase type is up-regulated in transformed rat thyroid cells.Ragno P., Cassano S., Degen J., Kessler C., Blasi F., Rossi G.FEBS Lett. 306:193-198(1992)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Rattus norvegicus (Rat)
Amount: 500ug
Available: In stock
Listprice: €1,272.85
Price: €1,272.85
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close