Comparison

Recombinant Human Protoporphyrinogen oxidase(PPOX)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-EP018502HU-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Short name:
PPO
AA Sequence
MGRTVVVLGGGISGLAASYHLSRAPCPPKVVLVES SERLGGWIRSVRGPNGAIFELGPRGIRPAGALGAR TLLLVSELGLDSEVLPVRGDHPAAQNRFLYVGGAL HALPTGLRGLLRPSPPFSKPLFWAGLRELTKPRGK EPDETVHSFAQRRLGPEVASLAMDSLCRGVFAGNS RELSIRSCFPSLFQAEQTHRSILLGLLLGAGRTPQ PDSALIRQALAERWSQWSLRGGLEMLPQALETHLT SRGVSVLRGQPVCGLSLQAEGRWKVSLRDSSLEAD HVISAIPASVLSELLPAEAAPLARALSAITAVSVA VVNLQYQGAHLPVQGFGHLVPSSEDPGVLGIVYDS VAFPEQDGSPPGLRVTVMLGGSWLQTLEASGCVLS QELFQQRAQEAAATQLGLKEMPSHCLVHLHKNCIP QYTLGHWQKLESARQFLTAHRLPLTLAGASYEGVA VNDCIESGRQAAVSVLGTEPNS
Research Topic
Metabolism
Uniprot ID
P50336
Gene Names
PPOX
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
1-477aa
MW of Fusion Proten
66, 8
Sequence Info
Full Length
Relevance
Catalyzes the 6-electron oxidation of protoporphyrinogen-IX to form protoporphyrin-IX.
Reference
"Cloning of a human cDNA for protoporphyrinogen oxidase by complementation in vivo of a hemG mutant of Escherichia coli."Nishimura K., Taketani S., Inokuchi H.J. Biol. Chem. 270:8076-8080(1995)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 1mg
Available: In stock
Listprice: €1,371.07
Price: €1,371.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close