Comparison

Recombinant Human Perforin-1(PRF1)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 500ug
Host E.coli
Item no. CSB-EP018668HU-500
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Cytolysin; Lymphocyte pore-forming protein ; PFP
AA Sequence
PCHTAARSECKRSHKFVPGAWLAGEGVDVTSLRRS GSFPVDTQRFLRPDGTCTLCENALQEGTLQRLPLA LTNWRAQGSGCQRHVTRAKVSSTEAVARDAARSIR NDWKVGLDVTPKPTSNVHVSVAGSHSQAANFAAQK THQDQYSFSTDTVECRFYSFHVVHTPPLHPDFKRA LGDLPHHFNASTQPAYLRLISNYGTHFIRAVELGG RISALTALRTCELALEGLTDNEVEDCLTVEAQVNI GIHGSISAEAKACEEKKKKHKMTASFHQTYRERHS EVVGGHHTSINDLLFGIQAGPEQYSAWVNSLPGSP GLVDYTLEPLHVLLDSQDPRREALRRALSQYLTDR ARWRDCSRPCPPGRQKSPRDPCQCVCHGSAVTTQD CCPRQRGLAQLEVTFIQAWGLWGDWFTATDAYVKL FFGGQELRTSTVWDNNNPIWSVRLDFGDVLLATGG PLRLQVWDQDSGRDDDLLGTCDQAPKSGSHEVRCN LNHGHLKFRYHARCLPHLGGGTCLDYVPQMLLGEP PGNRSGAVW
Research Topic
Immunology
Uniprot ID
P14222
Gene Names
PRF1
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
22-555aa
MW of Fusion Proten
75, 2
Sequence Info
Full Length
Relevance
Plays a key role in secretory granule-dependent cell death, and in defense against virus-infected or neoplastic cells. Plays an important role in killing other cells that are recognized as non-self by the immune syst, e.g. in transplant rejection or some forms of autoimmune disease. Can insert into the mbrane of target cells in its calcium-bound form, oligomerize and form large pores. Promotes cytolysis and apoptosis of target cells by facilitating the uptake of cytotoxic granzymes.
Reference
The DNA sequence and comparative analysis of human chromosome 10.Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.Nature 429:375-381(2004)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 500ug
Available: In stock
Listprice: €880.00
Price: €880.00
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close