Comparison

Recombinant Human DNA primase small subunit(PRIM1)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-EP018680HU-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
DNA primase 49 kDa subunit
Short name:
p49
AA Sequence
METFDPTELPELLKLYYRRLFPYSQYYRWLNYGGV IKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEM QKMNPYKIDIGAVYSHRPNQHNTVKLGAFQAQEKE LVFDIDMTDYDDVRRCCSSADICPKCWTLMTMAIR IIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVR KLSSAVRSGIVEYLSLVKGGQDVKKKVHLSEKIHP FIRKSINIIKKYFEEYALVNQDILENKESWDKILA LVPETIHDELQQSFQKSHNSLQRWEHLKKVASRYQ NNIKNDKYGPWLEWEIMLQYCFPRLDINVSKGINH LLKSPFSVHPKTGRISVPIDLQKVDQFDPFTVPTI SFICRELDAISTNEEEKEENEAESDVKHRTRDYKK TSLAPYVKVFEHFLENLDKSRKGELLKKSDLQKDF
Research Topic
Others
Uniprot ID
P49642
Gene Names
PRIM1
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
1-420aa
MW of Fusion Proten
65, 9
Sequence Info
Full Length
Relevance
DNA primase is the polymerase that synthesizes small RNA primers for the Okazaki fragments made during discontinuous DNA replication.
Reference
"Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features."
Bienvenut W.V., Sumpton D., Martinez A., Lilla S., Espagne C., Meinnel T., Giglione C.Mol. Cell. Proteomics 11:M111.015131-M111.015131(2012)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 1mg
Available: In stock
Listprice: €1,371.07
Price: €1,371.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close