« Back
Home /
Recombinant Human Proteasome subunit beta type-10(PSMB10)

Recombinant Human Proteasome subunit beta type-10(PSMB10)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	1mg
Host	E.coli
Item no.	CSB-EP018877HU-1
Conjugate/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Areas	Immunology
Uniprot ID	P40306
Gene Names	PSMB10
Organism	Homo sapiens (Human)
AA Sequence	MLKPALEPRGGFSFENCQRNASLERVLPGLKVPHA RKTGTTIAGLVFQDGVILGADTRATNDSVVADKSC EKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELH ALSTGREPRVATVTRILRQTLFRYQGHVGASLIVG GVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALA VLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGG NVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVP GTTAVLTQTVKPLTLELVEETVQAMEVE
Expression Region	1-273aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	51.6 kDa
Alternative Name(s)	Low molecular mass protein 10 Macropain subunit MECl-1 Multicatalytic endopeptidase complex subunit MECl-1 Proteasome MECl-1 Proteasome subunit beta-2i
Relevance	The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides.
Reference	A tight cluster of five unrelated human genes on chromosome 16q22.1. Larsen F., Solheim J., Kristensen T., Kolstoe A.-B., Prydz H. Hum. Mol. Genet. 2:1589-1595(1993)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides.
Subcellular Location	Cytoplasm, Nucleus
Protein Families	Peptidase T1B family
Tag Information	N-terminal GST-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP018877HU-1-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Request delivery time