Comparison

Recombinant Human Prostaglandin-H2 D-isomerase(PTGDS)

Manufacturer Cusabio
Category
Type Proteins Recombinant
Specific against other
Format Liquid or Lyophilized powder
Amount 10ug
Host E.coli
Item no. CSB-EP018969HU-10
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research areas
Metabolism
Target / Protein
PTGDS
Biologically active
Not Test
Expression system
E.coli
Species of origin
Homo sapiens (Human)
Uniprot ID
P41222
AA Sequence
APEAQVSVQPNFQQDKFLGRWFSAGLASNSSWLRE KKAALSMCKSVVAPATDGGLNLTSTFLRKNQCETR TMLLQPAGSLGSYSYRSPHWGSTYSVSVVETDYDQ YALLYSQGSKGPGEDFRMATLYSRTQTPRAELKEK FTAFCKAQGFTEDTIVFLPQTDKCMTEQ
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
23-190aa
Protein length
Full Length of Mature Protein
MW
34.7 kDa
Alternative Name(s)
Beta-trace protein; Cerebrin-28Glutathione-independent PGD synthaseLipocalin-type prostaglandin-D synthaseProstaglandin-D2 synthase ; PGD2 synthase ; PGDS ; PGDS2
Relevance
Catalyzes the conversion of PGH2 to PGD2, a prostaglandin involved in smooth muscle contraction/relaxation and a potent inhibitor of platelet aggregation. Involved in a variety of CNS functions, such as sedation, NR sleep and PGE2-induced allodynia, and may have an anti-apoptotic role in oligodendrocytes. Binds small non-substrate lipophilic molecules, including biliverdin, bilirubin, retinal, retinoic acid and thyroid hormone, and may act as a scavenger for harmful hydrophopic molecules and as a secretory retinoid and thyroid hormone transporter. Possibly involved in development and maintenance of the blood-brain, blood-retina, blood-aqueous humor and blood-testis barrier. It is likely to play important roles in both maturation and maintenance of the central nervous syst and male reproductive syst.
References
Human brain prostaglandin D synthase has been evolutionarily differentiated from lipophilic-ligand carrier proteins.Nagata A., Suzuki Y., Igarashi M., Eguchi N., Toh H., Urade Y., Hayaishi O.Proc. Natl. Acad. Sci. U.S.A. 88:4020-4024(1991)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Catalyzes the conversion of PGH2 to PGD2, a prostaglandin involved in smooth muscle contraction/relaxation and a potent inhibitor of platelet aggregation. Involved in a variety of CNS functions, such as sedation, NREM sleep and PGE2-induced allodynia, and may have an anti-apoptotic role in oligodendrocytes. Binds small non-substrate lipophilic molecules, including biliverdin, bilirubin, retinal, retinoic acid and thyroid hormone, and may act as a scavenger for harmful hydrophopic molecules and as a secretory retinoid and thyroid hormone transporter. Possibly involved in development and maintenance of the blood-brain, blood-retina, blood-aqueous humor and blood-testis barrier. It is likely to play important roles in both maturation and maintenance of the central nervous system and male reproductive system.
Subcellular Location
Rough endoplasmic reticulum, Nucleus membrane, Golgi apparatus, Cytoplasm, perinuclear region, Secreted
Protein Families
Calycin superfamily, Lipocalin family
Tissue Specificity
Abundant in the brain and CNS, where it is expressed in tissues of the blood-brain barrier and secreted into the cerebro-spinal fluid. Abundantly expressed in the heart. In the male reproductive system, it is expressed in the testis, epididymis and prostate, and is secreted into the seminal fluid. Expressed in the eye and secreted into the aqueous humor. Lower levels detected in various tissue fluids such as serum, normal urine, ascitic fluid and tear fluid. Also found in a number of other organs including ovary, fimbriae of the fallopian tubes, kidney, leukocytes.
Tag Information
N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close