Comparison

Recombinant Human Poliovirus receptor(PVR),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-EP019093HU-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Nectin-like protein 5
Short name:
NECL-5
CD_antigen: CD155
AA Sequence
WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPN MEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESK RLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLF VTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEP VPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGF LSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEK PQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLT CDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIR PVDKPINTTLICNVTNALGARQAELTVQVKEGPPS EHSGISRN
Research Topic
Microbiology
Uniprot ID
P15151
Gene Names
PVR
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
21-343aa
MW of Fusion Proten
51, 1
Sequence Info
Extracellular Domain
Relevance
Mediates NK cell adhesion and triggers NK cell effector functions. Binds two different NK cell receptors: CD96 and CD226. These interactions accumulates at the cell-cell contact site, leading to the formation of a mature immunological synapse between NK cell and target cell. This may trigger adhesion and secretion of lytic granules and IFN-gamma and activate cytoxicity of activated NK cells. May also promote NK cell-target cell modular exchange, and PVR transfer to the NK cell. This transfer is more important in some tumor cells expressing a lot of PVR, and may trigger fratricide NK cell activation, providing tumors with a mechanism of immunoevasion. Plays a role in mediating tumor cell invasion and migration.
Reference
"CD155/PVR plays a key role in cell motility during tumor cell invasion and migration."Sloan K.E., Eustace B.K., Stewart J.K., Zehetmeier C., Torella C., Simeone M., Roy J.E., Unger C., Louis D.N., Ilag L.L., Jay D.G.BMC Cancer 4:73-73(2004).
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 1mg
Available: In stock
Listprice: €1,371.07
Price: €1,371.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close