Comparison

Recombinant Human t Pyrroline-5-carboxylate reductase 1, mitochondrial(PYCR1)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-EP019115HU-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
AA Sequence
MEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAYAFT ALDALADGGVKMGLPRRLAVRLGAQALLGAAKMLL HSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSL LINAVEASCIRTRELQSMADQEQVSPAAIKKTILD KVKLDSPAGTALSPSGHTKLLPRSLAPAGKD
Research Topic
Metabolism
Uniprot ID
Q8TBX0
Gene Names
PYCR1
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
1-171aa
MW of Fusion Proten
33, 7
Sequence Info
Full Length
Reference
"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."The MGC Project Team Gerhard D.S., Wagner L., Feingold E.A., Shenmen C.M., Grouse L.H., Schuler G., Klein S.L., Old S., Rasooly R., Good P., Guyer M., Peck A.M., Derge J.G., Lipman D., Collins F.S., Jang W., Sherry S., Feolo M. Malek J.Genome Res. 14:2121-2127(2004)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 200ug
Available: In stock
Listprice: €546.07
Price: €546.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close