Comparison

Recombinant Human Glycogen phosphorylase, muscle form(PYGM)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-EP019123HU-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Myophosphorylase
AA Sequence
SRPLSDQDKRKQISVRGLAGVENVSDLKKNFNRHL HFTLVKDRNVATPRDYYFALAHTVRDHLVDRWIRT QQHYYAKDPKRIYYLSLELYMGRTLQNTMVNLALE NACDEATYQLGLDMEELEEIEEDAGLGNGGLGRLA ACFLDSMATLGLAAYGYGIRYEFGIFNQKICGGWQ MEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTS QGAKWVDTQVVLAMPYDTPVPGYRNNVVNTMRLWS AKAPPYFNLKDFNVGGYIQAVLDRNLAENISRVLY PNDKFFEGKELRLKQEYFVVAATLQDIIRRFKSSK FGCRDPVRTNFDAFPDKVAIQLNDTHPSLAIPELI RILVDLERLDWDKAWDVTVKTCAYTNHTVLPEALE RWPVHLMETLLPRHLQIIYEINQRFLNRVAAAFPG DVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGV ARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRR WLVLCNPGLAEVIAERIGEEYISDLDQLRKLLSYL DDQAFIRDVAKVKQENKLKFSAYLETEYKVHINPN SLFDVQVKRIHEYKRQLLNCLHIITLYNRIKREPN RFMVPRTIMIGGKAAPGYHMAKMIIKLITAIGDVV NHDPAVGDRFRVIFLENYRVSLAEKVIPAADLSEQ ISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMA EEAGEDNFFIFGMRVEDVERLDQRGYNAQEYYDRI PELRQIIEQLSSGFFSPKQPDLFKDIVNMVMHHDR FKVFADYEEYIKCQDKVSELYKNPREWTRMVIRNI ATSGKFSSDRTIAQYAREIWGLEPSRQRLPAPDEK
Research Topic
Cancer
Uniprot ID
P11217
Gene Names
PYGM
Tag Info
N-terminal 6xHis-tagged
Expression Region
2-842aa
MW of Fusion Proten
101, 1
Sequence Info
Full Length
Relevance
Phosphorylase is an important allosteric enzyme in carbohydrate metabolism. Enzymes from different sources differ in their regulatory mechanisms and in their natural substrates. However, all known phosphorylases share catalytic and structural properties.
Reference
"Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues."Lundby A., Secher A., Lage K., Nordsborg N.B., Dmytriyev A., Lundby C., Olsen J.V.Nat. Commun. 3:876-876(2012)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 200ug
Available: Out of stock
Listprice: €546.07
Price: €546.07
nicht lieferbar

Fragen Sie nach einem alternativen Produkt

Questions about this Product?
 
Close