Comparison

Recombinant Human Pregnancy zone protein(PZP),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Format Liquid
Amount 1mg
Host E.coli
Item no. CSB-EP019131HU-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
C3 and PZP-like alpha-2-macroglobulin domain-containing protein 6
AA Sequence
MKPEAELSVSSVYNLLTVKDLTNFPDNVDQQEEEQ GHCPRPFFIHNGAIYVPLSSNEADIYSFLKGMGLK VFTNSKIRKPKSCSVIPSVSAGAVGQGYYGAGLGV VERPYVPQLGTYNVIPLNNEQSSGPVPETVRSYFP ETWIWELVAVNSSGVAEVGVTVPDTITEWKAGAFC LSEDAGLGISSTASLRAFQPFFVELTMPYSVIRGE VFTLKATVLNYLPKCIRAEGIEQEKTFSSMTCASG ANVSEQLSLKLPSNVVKESARASFSVLGDILGSAM QNIQNLLQMPYGCGEQNMVLFAPNIYVLNYLNETQ QLTQEIKAKAVGYLITGYQRQLNYKHQDGSYSTFG
Research Topic
Neuroscience
Uniprot ID
P20742
Gene Names
PZP
Tag Info
N-terminal 6xHis-tagged
Expression Region
472-821aa
MW of Fusion Proten
42, 3
Sequence Info
Partial of Isoform 2
Relevance
Is able to inhibit all four classes of proteinases by a unique 'trapping' mechanism. This protein has a peptide stretch, called the 'bait region' which contains specific cleavage sites for different proteinases. When a proteinase cleaves the bait region, a conformational change is induced in the protein which traps the proteinase. The entrapped enzyme rains active against low molecular weight substrates (activity against high molecular weight substrates is greatly reduced). Following cleavage in the bait region a thioester bond is hydrolyzed and mediates the covalent binding of the protein to the proteinase.
Reference
Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 1mg
Available: In stock
Listprice: €1,371.07
Price: €1,371.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close