Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
Human |
Format |
Liquid or Lyophilized powder |
Amount |
1mg |
Host |
E.coli |
Item no. |
CSB-EP019131HU-1 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Areas |
Neuroscience |
Target / Protein |
PZP |
Biologically Active |
Not Test |
Expression System |
E.coli |
Species of origin |
Homo sapiens (Human) |
Uniprot ID |
P20742 |
AA Sequence |
MKPEAELSVSSVYNLLTVKDLTNFPDNVDQQEEEQ GHCPRPFFIHNGAIYVPLSSNEADIYSFLKGMGLK VFTNSKIRKPKSCSVIPSVSAGAVGQGYYGAGLGV VERPYVPQLGTYNVIPLNNEQSSGPVPETVRSYFP ETWIWELVAVNSSGVAEVGVTVPDTITEWKAGAFC LSEDAGLGISSTASLRAFQPFFVELTMPYSVIRGE VFTLKATVLNYLPKCIRAEGIEQEKTFSSMTCASG ANVSEQLSLKLPSNVVKESARASFSVLGDILGSAM QNIQNLLQMPYGCGEQNMVLFAPNIYVLNYLNETQ QLTQEIKAKAVGYLITGYQRQLNYKHQDGSYSTFG |
Tag Info |
N-terminal 6xHis-tagged |
Expression Region |
472-821aa |
Protein Length |
Partial of Isoform 2 |
MW |
42.3 kDa |
Distributor Discount |
50% off the list price |
Alternative Name(s) |
C3 and PZP-like alpha-2-macroglobulin domain-containing protein 6 |
Relevance |
Is able to inhibit all four classes of proteinases by a unique 'trapping' mechanism. This protein has a peptide stretch, called the 'bait region' which contains specific cleavage sites for different proteinases. When a proteinase cleaves the bait region, a conformational change is induced in the protein which traps the proteinase. The entrapped enzyme rains active against low molecular weight substrates (activity against high molecular weight substrates is greatly reduced). Following cleavage in the bait region a thioester bond is hydrolyzed and mediates the covalent binding of the protein to the proteinase. |
Reference |
Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Is able to inhibit all four classes of proteinases by a unique 'trapping' mechanism. This protein has a peptide stretch, called the 'bait region' which contains specific cleavage sites for different proteinases. When a proteinase cleaves the bait region, a conformational change is induced in the protein which traps the proteinase. The entrapped enzyme remains active against low molecular weight substrates (activity against high molecular weight substrates is greatly reduced). Following cleavage in the bait region a thioester bond is hydrolyzed and mediates the covalent binding of the protein to the proteinase. |
Subcellular Location |
Secreted |
Protein Families |
Protease inhibitor I39 (alpha-2-macroglobulin) family |
Tissue Specificity |
Plasma. Prominent constituent of late-pregnancy sera. |
Tag Information |
N-terminal 6xHis-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.