Comparison

Recombinant Human Ras-related protein Rab-11A(RAB11A)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Format Liquid
Amount 100ug
Host E.coli
Item no. CSB-EP019153HU-100
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
YL8
AA Sequence
GTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEF NLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQE RYRAITSAYYRGAVGALLVYDIAKHLTYENVERWL KELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARA FAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIV SQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQ CC
Research Topic
Cancer
Uniprot ID
P62491
Gene Names
RAB11A
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
2-213AA
MW of Fusion Proten
39, 9
Sequence Info
Full Length
Relevance
The small GTPases Rab are key regulators of intracellular mbrane trafficking, from the formation of transport vesicles to their fusion with mbranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to mbranes different set of downstream effectors directly responsible for vesicle formation, movent, tethering and fusion. That Rab regulates endocytic recycling. Acts as a major regulator of mbrane delivery during cytokinesis. Together with MYO5B and RAB8A participates in epithelial cell polarization. Together with RAB3IP, RAB8A, the exocyst complex, PARD3, PRKCI, ANXA2, CDC42 and DNMBP promotes transcytosis of PODXL to the apical mbrane initiation sites (AMIS), apical surface formation and lumenogenesis. Together with MYO5B participates in CFTR trafficking to the plasma mbrane and TF (Transferrin) recycling in nonpolarized cells. Required in a complex with MYO5B and RAB11FIP2 for the transport of NPC1L1 to the plasma mbrane. Participates in the sorting and basolateral transport of CDH1 from the Golgi apparatus to the plasma mbrane. Regulates the recycling of FCGRT (receptor of Fc region of monomeric Ig G) to basolateral mbranes. May also play a role in melanosome transport and release from melanocytes.
Reference
Identification and characterization of a human homolog of the Schizosaccharomyces pombe ras-like gene YPT-3.Drivas G.T., Shih A., Coutavas E.E., D'Eustachio P., Rush M.G.Oncogene 6:3-9(1991)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 100ug
Available: In stock
Listprice: €353.57
Price: €353.57
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close