Comparison

Recombinant Human UV excision repair protein RAD23 homolog A(RAD23A)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Format Liquid
Amount 1mg
Host E.coli
Item no. CSB-EP019259HU-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
AA Sequence
MAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAE KGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEKN FVVVMVTKTKAGQGTSAPPEASPTAAPESSTSFPP APTSGMSHPPPAAREDKSPSEESAPTTSPESVSGS VPSSGSSGREEDAASTLVTGSEYETMLTEIMSMGY ERERVVAALRASYNNPHRAVEYLLTGIPGSPEPEH GSVQESQVSEQPATEAAGENPLEFLRDQPQFQNMR QVIQQNPALLPALLQQLGQENPQLLQQISRHQEQF IQMLNEPPGELADISDVEGEVGAIGEEAPQMNYIQ VTPQEKEAIERLKALGFPESLVIQAYFACEKNENL AANFLLSQNFDDE
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
P54725
Gene Names
RAD23A
Tag Info
N-terminal GST-tagged
Expression Region
1-363aa
MW of Fusion Proten
66, 6
Sequence Info
Full Length
Relevance
Multiubiquitin chain receptor involved in modulation of proteasomal degradation. Binds to 'Lys-48'-linked polyubiquitin chains in a length-dependent manner and with a lower affinity to 'Lys-63'-linked polyubiquitin chains. Proposed to be capable to bind simultaneously to the 26S proteasome and to polyubiquitinated substrates and to deliver ubiquitinated proteins to the proteasome.Involved in nucleotide excision repair and is thought to be functional equivalent for RAD23B in global genome nucleotide excision repair (GG-NER) by association with XPC. In vitro, the XPC:RAD23A dimer has NER activity. Can stabilize XPC.Involved in vpr-dependent replication of HIV-1 in non-proliferating cells and primary macrophages. Required for the association of HIV-1 vpr with the host proteasome.
Reference
Components of the ubiquitin-proteasome pathway compete for surfaces on Rad23 family proteins.Goh A.M., Walters K.J., Elsasser S., Verma R., Deshaies R.J., Finley D., Howley P.M.BMC Biochem. 9:4-4(2008)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 1mg
Available: In stock
Listprice: €1,371.07
Price: €1,371.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close