Comparison

Recombinant Human Ras-related protein Ral-B(RALB)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP019297HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
AA Sequence
MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFM YDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTA GQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATA EFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPV EEARSKAEEWGVQYVETSAKTRANVDKVFFDLMRE IRTKKMSENKDKNGKKSSKNKKSFKERC
Research Topic
Signal Transduction
Uniprot ID
P11234
Gene Names
RALB
Tag Info
N-terminal GST-tagged
Expression Region
1-206aa
MW of Fusion Proten
50, 1
Sequence Info
Full Length
Relevance
Multifunctional GTPase involved in a variety of cellular processes including gene expression, cell migration, cell proliferation, oncogenic transformation and membrane trafficking. Accomplishes its multiple functions by interacting with distinct downstream effectors. Acts as a GTP sensor for GTP-dependent exocytosis of dense core vesicles. Required both to stabilize the assembly of the exocyst complex and to localize functional exocyst complexes to the leading edge of migrating cells. Plays a role in the late stages of cytokinesis and is required for the abscission of the bridge joining the sister cells emerging from mitosis. Required for suppression of apoptosis.
Reference
"Chromosomal localization and cDNA sequence of human ralB, a GTP binding protein."
Hsieh C.-L., Swaroop A., Francke U.
Somat. Cell Mol. Genet. 16:407-410(1990)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 10ug
Available: In stock
Listprice: €154.00
Price: €154.00
lieferbar

Compare

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close