Recombinant Human Ras-related protein Ral-B(RALB)

Signal Transduction

RALB

MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFM YDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTA GQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATA EFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPV EEARSKAEEWGVQYVETSAKTRANVDKVFFDLMRE IRTKKMSENKDKNGKKSSKNKKSFKERC

Full Length

N-terminal GST-tagged

Multifunctional GTPase involved in a variety of cellular processes including gene expression, cell migration, cell proliferation, oncogenic transformation and membrane trafficking. Accomplishes its multiple functions by interacting with distinct downstream effectors. Acts as a GTP sensor for GTP-dependent exocytosis of dense core vesicles. Required both to stabilize the assembly of the exocyst complex and to localize functional exocyst complexes to the leading edge of migrating cells. Plays a role in the late stages of cytokinesis and is required for the abscission of the bridge joining the sister cells emerging from mitosis. Required for suppression of apoptosis.

Greater than 90% as determined by SDS-PAGE.

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.

Multifunctional GTPase involved in a variety of cellular processes including gene expression, cell migration, cell proliferation, oncogenic transformation and membrane trafficking. Accomplishes its multiple functions by interacting with distinct downstream effectors. Acts as a GTP sensor for GTP-dependent exocytosis of dense core vesicles (By similarity). Required both to stabilize the assembly of the exocyst complex and to localize functional exocyst complexes to the leading edge of migrating cells (By similarity). Required for suppression of apoptosis

Small GTPase superfamily, Ras family

N-terminal GST-tagged