Comparison

Recombinant Human RNA binding protein fox-1 homolog 2(RBFOX2)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP019439HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Fox-1 homolog BHexaribonucleotide-binding protein 2RNA-binding motif protein 9RNA-binding protein 9Repressor of tamoxifen transcriptional activity
AA Sequence
MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQ NGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGE QSSNSPSTQNGSLTTEGGAQTDGQQSQTQSSENSE SKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDV EIIFNERGSKGFGFVTFENSADADRAREKLHGTVV EGRKIEVNNATARVMTNKKMVTPYANGWKLSPVVG AVYGPELYAASSFQADVSLGNDAAVPLSGRGGINT YIPLISLPLVPGFPYPTAATTAAAFRGAHLRGRGR TVYGAVRAVPPTAIPAYPGVVYQDGFYGADLYGGY AAYRYAQPATATAATAAAAAAAAYSDGYGRVYTAD PYHALAPAASYGVGAVASLYRGGYSRFAPY
Research Topic
Transcription
Uniprot ID
O43251
Gene Names
RBFOX2
Tag Info
N-terminal 6xHis-tagged
Expression Region
1-380aa
MW of Fusion Proten
44, 4
Sequence Info
Full Length of Isoform 10
Relevance
RNA-binding protein that regulates alternative splicing events by binding to 5'-UGCAUGU-3' elents. Prevents binding of U2AF2 to the 3'-splice site. Regulates alternative splicing of tissue-specific exons and of differentially spliced exons during erythropoiesis . RNA-binding protein that ses to act as a coregulatory factor of ER-alpha.1 Publication
Reference
XRbm9, a new XGld2-interacting protein, enhances translation in Xenopus oocytes.Papin C.Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 10ug
Available: In stock
Listprice: €154.00
Price: €154.00
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close