« Back
Home /
Recombinant Human RNA binding protein fox-1 homolog 2(RBFOX2)

Recombinant Human RNA binding protein fox-1 homolog 2(RBFOX2)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	10ug
Host	E.coli
Item no.	CSB-EP019439HU-10
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Transcription
Uniprot ID	O43251
Gene Names	RBFOX2
Organism	Homo sapiens (Human)
AA Sequence	MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQ NGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGE QSSNSPSTQNGSLTTEGGAQTDGQQSQTQSSENSE SKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDV EIIFNERGSKGFGFVTFENSADADRAREKLHGTVV EGRKIEVNNATARVMTNKKMVTPYANGWKLSPVVG AVYGPELYAASSFQADVSLGNDAAVPLSGRGGINT YIPLISLPLVPGFPYPTAATTAAAFRGAHLRGRGR TVYGAVRAVPPTAIPAYPGVVYQDGFYGADLYGGY AAYRYAQPATATAATAAAAAAAAYSDGYGRVYTAD PYHALAPAASYGVGAVASLYRGGYSRFAPY
Expression Region	1-380aa
Sequence Info	Full Length of Isoform 10
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	44.4 kDa
Alternative Name(s)	Fox-1 homolog BHexaribonucleotide-binding protein 2RNA-binding motif protein 9RNA-binding protein 9Repressor of tamoxifen transcriptional activity
Relevance	RNA-binding protein that regulates alternative splicing events by binding to 5'-UGCAUGU-3' elents. Prevents binding of U2AF2 to the 3'-splice site. Regulates alternative splicing of tissue-specific exons and of differentially spliced exons during erythropoiesis . RNA-binding protein that ses to act as a coregulatory factor of ER-alpha.1 Publication
Reference	XRbm9, a new XGld2-interacting protein, enhances translation in Xenopus oocytes.Papin C.Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	RNA-binding protein that regulates alternative splicing events by binding to 5'-UGCAUGU-3' elements. Prevents binding of U2AF2 to the 3'-splice site. Regulates alternative splicing of tissue-specific exons and of differentially spliced exons during erythropoiesis (By similarity). RNA-binding protein that seems to act as a coregulatory factor of ER-alpha.
Subcellular Location	Nucleus, Cytoplasm
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time