Comparison

Recombinant Human Retinol-binding protein 3(RBP3),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP019482BO-100
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Others
Uniprot ID
P12661
Gene Names
RBP3
Organism
Bos taurus (Bovine)
AA Sequence
AKVPTVLQTAGKLVADNYASPELGVKMAAELSGLQ SRYARVTSEAALAELLQADLQVLSGDPHLKTAHIP EDAKDRIPGIVPMQIPSPEVFEDLIKFSFHTNVLE GNVGYLRFDMFGDCELLTQVSELLVEHVWKKIVHT DALIVDMRFNIGGPTSSISALCSYFFDEGPPILLD KIYNRPNNSVSELWTLSQLEGERYGSKKSMVILTS TLTAGAAEEFTYIMKRLGRALVIGEVTSGGCQPPQ TYHVDDTDLYLTIPTARSVGAADGSSWEGVGVVPD VAVPAEAALTRAQEMLQHT
Expression Region
933-1231aa
Sequence Info
Partial
Source
E.coli
Tag Info
N-terminal GST-tagged
MW
59.5 kDa
Alternative Name
Interphotoreceptor retinoid-binding protein . IRBPInterstitial retinol-binding protein
Relevance
IRBP shuttles 11-cis and all trans retinoids between the retinol isomerase in the pigment epithelium and the visual pigments in the photoreceptor cells of the retina.
Reference
Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.Oshikawa M., Tsutsui C., Ikegami T., Fuchida Y., Matsubara M., Toyama S., Usami R., Ohtoko K., Kato S.Invest. Ophthalmol. Vis. Sci. 52:6662-6670(2011)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
IRBP shuttles 11-cis and all trans retinoids between the retinol isomerase in the pigment epithelium and the visual pigments in the photoreceptor cells of the retina.
Subcellular Location
Secreted, extracellular space, extracellular matrix, interphotoreceptor matrix
Protein Families
Peptidase S41A family
Amount: 100ug
Available: In stock
Listprice: €405.35
Price: €405.35
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close