« Back
Home /
Recombinant human Retinol dehydrogenase 11(RDH11),partial

Recombinant human Retinol dehydrogenase 11(RDH11),partial

Manufacturer	Cusabio
Category	Oncology Peptides & Proteins Recombinant Proteins By Organ Testicular & Prostate Cancer
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	1mg
Host	E.coli
Item no.	CSB-EP019523HU-1
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Areas	Neuroscience
Uniprot ID	Q8TC12
Gene Names	RDH11
Organism	Homo sapiens (Human)
AA Sequence	PQIRKMLSSGVCTSTVQLPGKVVVVTGANTGIGKE TAKELAQRGARVYLACRDVEKGELVAKEIQTTTGN QQVLVRKLDLSDTKSIRAFAKGFLAEEKHLHVLIN NAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLL EKLKESAPSRIVNVSSLAHHLGRIHFHNLQGEKFY NAGLAYCHSKLANILFTQELARRLKGSGVTTYSVH PGTVQSELVRHSSFMRWMWWLFSFFIKTPQQGAQT SLHCALTEGLEILSGNHFSDCHVAWVSAQARNETI ARRLWDVSCDLLGLPID
Expression Region	22-318aa
Sequence Info	Cytoplasmic Domain
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	49 kDa
Alternative Name(s)	Androgen-regulated short-chain dehydrogenase/reductase 1HCV core-binding protein HCBP12; Prostate short-chain dehydrogenase/reductase 1Retinal reductase 1 ; RalR1Short chain dehydrogenase/reductase family 7C member 1
Relevance	Exhibits an oxidoreductive catalytic activity towards retinoids. Most efficient as an NADPH-dependent retinal reductase. Displays high activity towards 9-cis and all-trans-retinol. Also involved in the metabolism of short-chain aldehydes. No steroid dehydrogenase activity detected.
Reference	Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Exhibits an oxidoreductive catalytic activity towards retinoids. Most efficient as an NADPH-dependent retinal reductase. Displays high activity towards 9-cis and all-trans-retinol. Also involved in the metabolism of short-chain aldehydes. No steroid dehydrogenase activity detected.
Involvement in disease	Retinal dystrophy, juvenile cataracts, and short stature syndrome (RDJCSS)
Subcellular Location	Endoplasmic reticulum membrane, Single-pass type II membrane protein
Protein Families	Short-chain dehydrogenases/reductases (SDR) family
Tissue Specificity	Predominantly expressed in the epithelial cells of prostate, in both basal and luminal secretory cell populations. Expressed at low levels in spleen, thymus, testis, ovary, small intestine, colon, peripherical blood leukocytes, kidney, adrenal gland and fetal liver. Not detected in prostatic fibromuscular stromal cells, endothelial cells, or infiltrating lymphocytes.
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP019523HU-1-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Request delivery time