Comparison

Recombinant Human Regenerating islet-derived protein 3-alpha(REG3A)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-EP019548HU-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Hepatointestinal pancreatic protein ; HIP/PAPHuman proislet peptidePancreatitis-associated protein 1Regenerating islet-derived protein III-alpha ; Reg III-alpha
AA Sequence
EEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSW TDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIG NSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYF AWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVR LPYVCKFTD
Research Topic
Immunology
Uniprot ID
Q06141
Gene Names
REG3A
Tag Info
N-terminal GST-tagged
Expression Region
27-175aa
MW of Fusion Proten
43, 6
Sequence Info
Full Length
Relevance
Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Regulates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway.
Reference
Molecular basis for peptidoglycan recognition by a bactericidal lectin.Lehotzky R.E., Partch C.L., Mukherjee S., Cash H.L., Goldman W.E., Gardner K.H., Hooper L.V.Proc. Natl. Acad. Sci. U.S.A. 107:7722-7727(2010)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 1mg
Available: In stock
Listprice: €1,371.07
Price: €1,371.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close