Comparison

Recombinant Human Regenerating islet-derived protein 3-alpha(REG3A)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-EP019548HU-1
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Immunology
Uniprot ID
Q06141
Gene Names
REG3A
Organism
Homo sapiens (Human)
AA Sequence
EEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSW TDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIG NSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYF AWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVR LPYVCKFTD
Expression Region
27-175aa
Sequence Info
Full Length of Mature Protein
Source
E.coli
Tag Info
N-terminal GST-tagged
MW
43.6 kDa
Alternative Name
Hepatointestinal pancreatic protein . HIP/PAPHuman proislet peptidePancreatitis-associated protein 1Regenerating islet-derived protein III-alpha . Reg III-alpha
Relevance
Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Regulates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway.
Reference
Molecular basis for peptidoglycan recognition by a bactericidal lectin.Lehotzky R.E., Partch C.L., Mukherjee S., Cash H.L., Goldman W.E., Gardner K.H., Hooper L.V.Proc. Natl. Acad. Sci. U.S.A. 107:7722-7727(2010)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Regulates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway.
Subcellular Location
Secreted
Tissue Specificity
Highly expressed in epidermal keratinocytes of psoriasis patients (at protein level). Constitutively expressed in intestine. Low expression is found in healthy pancreas. Overexpressed during the acute phase of pancreatitis and in some patients with chronic pancreatitis.
Amount: 1mg
Available: In stock
Listprice: €1,552.27
Price: €1,552.27
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close