Recombinant Human RING finger protein 114(RNF114)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 10ug
Host E.coli
ArtNr CSB-EP019821HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
Q9Y508
Gene Names
RNF114
Organism
Homo sapiens (Human)
AA Sequence
MAAQQRDCGGAAQLAGPAAEADPLGRFTCPVCLEV YEKPVQVPCGHVFCSACLQECLKPKKPVCGVCRSA LAPGVRAVELERQIESTETSCHGCRKNFFLSKIRS HVATCSKYQNYIMEGVKATIKDASLQPRNVPNRYT FPCPYCPEKNFDQEGLVEHCKLFHSTDTKSVVCPI CASMPWGDPNYRSANFREHIQRRHRFSYDTFVDYD VDEEDMMNQVLQRSIIDQ
Expression Region
1-228aa
Sequence Info
Full Length
Tag Info
N-terminal GST-tagged
MW
52.7 kDa
Alternative Name(s)
RING finger protein 114
Zinc finger protein 228
Zinc finger protein 313
Relevance
E3 ubiquitin-protein ligase promoting the ubiquitination and degradation of the CDK inhibitor CDKN1A and probably also CDKN1B and CDKN1C. These activities stimulate cell cycle's G1-to-S phase transition and suppress cellular senescence. May play a role in spermatogenesis.
Reference
"Identification of a novel human zinc finger protein gene ZNF313."
Ma Y.-X., Zhang S., Hou Y., Huang X., Wu Q., Sun Y.
Sheng Wu Hua Xue Yu Sheng Wu Wu Li Xue Bao 35:230-237(2003)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €140.00
Price: €140.00
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close