Comparison

Recombinant Human Tyrosine-protein kinase transmembrane receptor ROR1(ROR1),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-EP020067HU-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Neurotrophic tyrosine kinase, receptor-related 1
AA Sequence
QETELSVSAELVPTSSWNISSELNKDSYLTLDEPM NNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVV QEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVAT NGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGF CQPYRGIACARFIGNRTVYMESLHMQGEIENQITA AFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETS SVPKPRDLCRDECEILENVLCQTEYIFARSNPMIL MRLKLPNCEDLPQPESPEAANCIRIGIPMADPINK NHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHT HTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDE NFKSDLCDIPAC
Research Topic
Neuroscience
Uniprot ID
Q01973
Gene Names
ROR1
Tag Info
N-terminal 6xHis-tagged
Expression Region
30-391aa
MW of Fusion Proten
44, 6
Sequence Info
Extracellular Domain
Relevance
Tyrosine-protein kinase receptor whose role is not yet clear.
Reference
Patterns of somatic mutation in human cancer genomes.Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.Nature 446:153-158(2007)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 1mg
Available: In stock
Listprice: €1,371.07
Price: €1,371.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close