Comparison

Recombinant Human Tyrosine-protein kinase transmembrane receptor ROR1(ROR1),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-EP020067HU-1
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Neuroscience
Uniprot ID
Q01973
Gene Names
ROR1
Organism
Homo sapiens (Human)
AA Sequence
QETELSVSAELVPTSSWNISSELNKDSYLTLDEPM NNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVV QEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVAT NGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGF CQPYRGIACARFIGNRTVYMESLHMQGEIENQITA AFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETS SVPKPRDLCRDECEILENVLCQTEYIFARSNPMIL MRLKLPNCEDLPQPESPEAANCIRIGIPMADPINK NHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHT HTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDE NFKSDLCDIPAC
Expression Region
30-391aa
Sequence Info
Extracellular Domain
Source
E.coli
Tag Info
N-terminal 6xHis-tagged
MW
44.6 kDa
Alternative Name
Neurotrophic tyrosine kinase, receptor-related 1
Relevance
Tyrosine-protein kinase receptor whose role is not yet clear.
Reference
Patterns of somatic mutation in human cancer genomes.Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.Nature 446:153-158(2007)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Has very low kinase activity in vitro and is unlikely to function as a tyrosine kinase in vivo
Involvement in disease
Deafness, autosomal recessive, 108 (DFNB108)
Subcellular Location
Membrane, Single-pass type I membrane protein, Cell projection, axon
Protein Families
Protein kinase superfamily, Tyr protein kinase family, ROR subfamily
Tissue Specificity
Expressed strongly in human heart, lung and kidney, but weakly in the CNS. Isoform Short is strongly expressed in fetal and adult CNS and in a variety of human cancers, including those originating from CNS or PNS neuroectoderm.
Amount: 1mg
Available: In stock
Listprice: €1,552.27
Price: €1,552.27
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close