Comparison

Recombinant Human Protein XRP2(RP2)

Item no. CSB-EP020076HU-10
Manufacturer Cusabio
Amount 10 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host E.coli
Conjugate/Tag GST
Purity Greater than 90% as determined by SDS-PAGE.
Sequence GCFFSKRRKADKESRPENEEERPKQYSWDQREKVD PKDYMFSGLKDETVGRLPGTVAGQQFLIQDCENCN IYIFDHSATVTIDDCTNCIIFLGPVKGSVFFRNCR DCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSS NIKFGCFQWYYPELAFQFKDAGLSIFNNTWSNIHD FTPVSGELNWSLLPEDAVVQDYVPIPTTEELKAVR VSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYT IAN
Protein Family TBCC family
Citations "Positional cloning of the gene for X-linked retinitis pigmentosa 2."
Schwahn U., Lenzner S., Dong J., Feil S., Hinzmann B., van Duijnhoven G., Kirschner R., Hemberger M., Bergen A.A.B., Rosenberg T., Pinckers A.J.L.G., Fundele R., Rosenthal A., Cremers F.P.M., Ropers H.-H., Berger W.
Nat. Genet. 19:327-332(1998)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Available
Manufacturer - Conjugate / Tag
N-terminal GST-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
66.5 kDa
General Research Areas
Neuroscience
Relevance
Acts as a GTPase-activating protein (GAP) involved in trafficking between the Golgi and the ciliary membrane. Involved in localization of proteins, such as NPHP3, to the cilium membrane by inducing hydrolysis of GTP ARL3, leading to the release of UNC119 (or UNC119B). Acts as a GTPase-activating protein (GAP) for tubulin in concert with tubulin-specific chaperone C, but does not enhance tubulin heterodimerization. Acts as guanine nucleotide dissociation inhibitor towards ADP-ribosylation factor-like proteins.
Expression Region
1-350aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Acts as a GTPase-activating protein (GAP) involved in trafficking between the Golgi and the ciliary membrane. Involved in localization of proteins, such as NPHP3, to the cilium membrane by inducing hydrolysis of GTP ARL3, leading to the release of UNC119 (or UNC119B). Acts as a GTPase-activating protein (GAP) for tubulin in concert with tubulin-specific chaperone C, but does not enhance tubulin heterodimerization. Acts as guanine nucleotide dissociation inhibitor towards ADP-ribosylation factor-like proteins.
Subcellular Location
Cell membrane, Lipid-anchor, Cytoplasmic side, Cell projection, cilium
Tissue Specificity
Ubiquitous. Expressed in the rod and cone photoreceptors, extending from the tips of the outer segment (OS) through the inner segment (IS) and outer nuclear layer (ONL) and into the synaptic terminals of the outer plexiform layer (ONL). Also detected in the bipolar, horizontal and amacrine cells in the inner nuclear layer (INL), extending to the inner plexiform layer (IPL) and though the ganglion cell layer (GCL) and into the nerve fiber layer (NFL) (at protein level).
Involvement in disease
Retinitis pigmentosa 2 (RP2)
Gene Names
RP2
Sequence Info
Full Length
Organism
Homo sapiens (Human)
Storage Buffer
Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close