« Back
Home /
Recombinant Human Protein XRP2(RP2)

Recombinant Human Protein XRP2(RP2)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	10ug
Host	E.coli
Item no.	CSB-EP020076HU-10
Conjugate/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Neuroscience
Uniprot ID	O75695
Gene Names	RP2
Organism	Homo sapiens (Human)
AA Sequence	GCFFSKRRKADKESRPENEEERPKQYSWDQREKVD PKDYMFSGLKDETVGRLPGTVAGQQFLIQDCENCN IYIFDHSATVTIDDCTNCIIFLGPVKGSVFFRNCR DCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSS NIKFGCFQWYYPELAFQFKDAGLSIFNNTWSNIHD FTPVSGELNWSLLPEDAVVQDYVPIPTTEELKAVR VSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYT IANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVF REKAPDFLPLLNKGPVIALEFNGDGAVEVCQLIVN EIFNGTKMFVSESKETASGDVDSFYNFADIQMGI
Expression Region	1-350aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	66.5 kDa
Relevance	Acts as a GTPase-activating protein (GAP) involved in trafficking between the Golgi and the ciliary membrane. Involved in localization of proteins, such as NPHP3, to the cilium membrane by inducing hydrolysis of GTP ARL3, leading to the release of UNC119 (or UNC119B). Acts as a GTPase-activating protein (GAP) for tubulin in concert with tubulin-specific chaperone C, but does not enhance tubulin heterodimerization. Acts as guanine nucleotide dissociation inhibitor towards ADP-ribosylation factor-like proteins.
Reference	"Positional cloning of the gene for X-linked retinitis pigmentosa 2." Schwahn U., Lenzner S., Dong J., Feil S., Hinzmann B., van Duijnhoven G., Kirschner R., Hemberger M., Bergen A.A.B., Rosenberg T., Pinckers A.J.L.G., Fundele R., Rosenthal A., Cremers F.P.M., Ropers H.-H., Berger W. Nat. Genet. 19:327-332(1998)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Acts as a GTPase-activating protein (GAP) involved in trafficking between the Golgi and the ciliary membrane. Involved in localization of proteins, such as NPHP3, to the cilium membrane by inducing hydrolysis of GTP ARL3, leading to the release of UNC119 (or UNC119B). Acts as a GTPase-activating protein (GAP) for tubulin in concert with tubulin-specific chaperone C, but does not enhance tubulin heterodimerization. Acts as guanine nucleotide dissociation inhibitor towards ADP-ribosylation factor-like proteins.
Involvement in disease	Retinitis pigmentosa 2 (RP2)
Subcellular Location	Cell membrane, Lipid-anchor, Cytoplasmic side, Cell projection, cilium
Protein Families	TBCC family
Tissue Specificity	Ubiquitous. Expressed in the rod and cone photoreceptors, extending from the tips of the outer segment (OS) through the inner segment (IS) and outer nuclear layer (ONL) and into the synaptic terminals of the outer plexiform layer (ONL). Also detected in the bipolar, horizontal and amacrine cells in the inner nuclear layer (INL), extending to the inner plexiform layer (IPL) and though the ganglion cell layer (GCL) and into the nerve fiber layer (NFL) (at protein level).
Tag Information	N-terminal GST-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time