Comparison

Recombinant Human 60S acidic ribosomal protein P1(RPLP1)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP020340HU-100
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
P05386
Gene Names
RPLP1
Organism
Homo sapiens (Human)
AA Sequence
ASVSELACIYSALILHDDEVTVTEDKINALIKAAG VNVEPFWPGLFAKALANVNIGSLICNVGAGGPAPA AGAAPAGGPAPSTAAAPAEEKKVEAKKEESEESDD DMGFGLFD
Expression Region
2-114aa
Sequence Info
Full Length of Mature Protein
Source
E.coli
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
27.4 kDa
Relevance
Plays an important role in the elongation step of protein synthesis.
Reference
"Human acidic ribosomal phosphoproteins P0, P1, and P2: analysis of cDNA clones, in vitro synthesis, and assembly."Rich B.E., Steitz J.A.Mol. Cell. Biol. 7:4065-4074(1987)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Plays an important role in the elongation step of protein synthesis.
Protein Families
Eukaryotic ribosomal protein P1/P2 family
Amount: 100ug
Available: In stock
Listprice: €405.35
Price: €405.35
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close