Comparison

Recombinant Human Ribonucleoside-diphosphate reductase large subunit(RRM1)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP020518HU-100
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Ribonucleoside-diphosphate reductase subunit M1Ribonucleotide reductase large subunit
AA Sequence
MHVIKRDGRQERVMFDKITSRIQKLCYGLNMDFVD PAQITMKVIQGLYSGVTTVELDTLAAETAATLTTK HPDYAILAARIAVSNLHKETKKVFSDVMEDLYNYI NPHNGKHSPMVAKSTLDIVLANKDRLNSAIIYDRD FSYNYFGFKTLERSYLLKINGKVAERPQHMLMRVS VGIHKEDIDAAIETYNLLSERWFTHASPTLFNAGT NRPQLSSCFLLSMKDDSIEGIYDTLKQCALISKSA GGIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYN NTARYVDQGGNKRPGAFAIYLEPWHLDIFEFLDLK KNTGKEEQRARDLFFALWIPDLFMKRVETNQDWSL MCPNECPGLDEVWGEEFEKLYASYEKQGRVRKVVK AQQLWYAIIESQTETGTPYMLYKDSCNRKSNQQNL GTIKCSNLCTEIVEYTSKDEVAVCNLASLALNMYV TSEHTYDFKKLAEVTKVVVRNLNKIIDINYYPVPE ACLSNKRHRPIGIGVQGLADAFILMRYPFESAEAQ LLNKQIFETIYYGALEASCDLAKEQGPYETYEGSP VSKGILQYDMWNVTPTDLWDWKVLKEKIAKYGIRN SLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVL SGEFQIVNPHLLKDLTERGLWHEEMKNQIIACNGS IQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGA FIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTG MYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEK ERNTAAMVCSLENRDECLMCGS
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
P23921
Gene Names
RRM1
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
1-792aa
MW of Fusion Proten
106, 1
Sequence Info
Full Length
Relevance
Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides.
Reference
Structural basis for allosteric regulation of human ribonucleotide reductase by nucleotide-induced oligomerization.Fairman J.W., Wijerathna S.R., Ahmad M.F., Xu H., Nakano R., Jha S., Prendergast J., Welin R.M., Flodin S., Roos A., Nordlund P., Li Z., Walz T., Dealwis C.G.Nat. Struct. Mol. Biol. 18:316-322(2011)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 100ug
Available: In stock
Listprice: €353.57
Price: €353.57
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close