Comparison

Recombinant Human Ribonucleoside-diphosphate reductase large subunit(RRM1)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP020518HU-100
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
P23921
Gene Names
RRM1
Organism
Homo sapiens (Human)
AA Sequence
MHVIKRDGRQERVMFDKITSRIQKLCYGLNMDFVD PAQITMKVIQGLYSGVTTVELDTLAAETAATLTTK HPDYAILAARIAVSNLHKETKKVFSDVMEDLYNYI NPHNGKHSPMVAKSTLDIVLANKDRLNSAIIYDRD FSYNYFGFKTLERSYLLKINGKVAERPQHMLMRVS VGIHKEDIDAAIETYNLLSERWFTHASPTLFNAGT NRPQLSSCFLLSMKDDSIEGIYDTLKQCALISKSA GGIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYN NTARYVDQGGNKRPGAFAIYLEPWHLDIFEFLDLK KNTGKEEQRARDLFFALWIPDLFMKRVETNQDWSL MCPNECPGLDEVWGEEFEKLYASYEKQGRVRKVVK AQQLWYAIIESQTETGTPYMLYKDSCNRKSNQQNL GTIKCSNLCTEIVEYTSKDEVAVCNLASLALNMYV TSEHTYDFKKLAEVTKVVVRNLNKIIDINYYPVPE ACLSNKRHRPIGIGVQGLADAFILMRYPFESAEAQ LLNKQIFETIYYGALEASCDLAKEQGPYETYEGSP VSKGILQYDMWNVTPTDLWDWKVLKEKIAKYGIRN SLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVL SGEFQIVNPHLLKDLTERGLWHEEMKNQIIACNGS IQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGA FIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTG MYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEK ERNTAAMVCSLENRDECLMCGS
Expression Region
1-792aa
Sequence Info
Full Length
Source
E.coli
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
106.1 kDa
Alternative Name
Ribonucleoside-diphosphate reductase subunit M1Ribonucleotide reductase large subunit
Relevance
Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides.
Reference
Structural basis for allosteric regulation of human ribonucleotide reductase by nucleotide-induced oligomerization.Fairman J.W., Wijerathna S.R., Ahmad M.F., Xu H., Nakano R., Jha S., Prendergast J., Welin R.M., Flodin S., Roos A., Nordlund P., Li Z., Walz T., Dealwis C.G.Nat. Struct. Mol. Biol. 18:316-322(2011)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides.
Subcellular Location
Cytoplasm
Protein Families
Ribonucleoside diphosphate reductase large chain family
Amount: 100ug
Available: In stock
Listprice: €405.35
Price: €405.35
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close