« Back
Home /
Recombinant Human Ribonucleoside-diphosphate reductase subunit M2(RRM2)

Recombinant Human Ribonucleoside-diphosphate reductase subunit M2(RRM2)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	100ug
Host	E.coli
Item no.	CSB-EP020519HU-100
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Areas	Transcription
Uniprot ID	P31350
Gene Names	RRM2
Organism	Homo sapiens (Human)
AA Sequence	MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPP ALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDE PLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAE EVDLSKDIQHWESLKPEERYFISHVLAFFAASDGI VNENLVERFSQEVQITEARCFYGFQIAMENIHSEM YSLLIDTYIKDPKEREFLFNAIETMPCVKKKADWA LRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFW LKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHL VHKPSEERVREIIINAVRIEQEFLTEALPVKLIGM NCTLMKQYIEFVADRLMLELGFSKVFRVENPFDFM ENISLEGKTNFFEKRVGEYQRMGVMSSPTENSFTL DADF
Expression Region	1-389a
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	60.9 kDa
Alternative Name(s)	Ribonucleotide reductase small chainRibonucleotide reductase small subunit
Relevance	Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides. Inhibits Wnt signaling.
Reference	System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.Sci. Signal. 4:RS3-RS3(2011)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides. Inhibits Wnt signaling.
Subcellular Location	Cytoplasm
Protein Families	Ribonucleoside diphosphate reductase small chain family
Paythway	p53signalingpathway
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP020519HU-100-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Request delivery time