Comparison

Recombinant Human Protein S100-A1(S100A1)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-EP020622HU-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
S-100 protein alpha chain; S-100 protein subunit alpha; S100 calcium-binding protein A1
AA Sequence
GSELETAMETLINVFHAHSGKEGDKYKLSKKELKE LLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVD FQEYVVLVAALTVACNNFFWENS
Research Topic
Signal Transduction
Uniprot ID
P23297
Gene Names
S100A1
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
2-94aa
MW of Fusion Proten
26, 4
Sequence Info
Full Length
Relevance
Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer. Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites. May mediate calcium-dependent regulation on many physiological processes by interacting with other proteins, such as TPR-containing proteins, and modulating their activity.
Reference
S100 alpha, CAPL, and CACY molecular cloning and expression analysis of three calcium-binding proteins from human heart.Engelkamp D., Schaefer B.W., Erne P., Heizmann C.W.Biochemistry 31:10258-10264(1992)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 1mg
Available: In stock
Listprice: €1,371.07
Price: €1,371.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close