« Back
Home /
Recombinant Human Protein S100-A1(S100A1)

Recombinant Human Protein S100-A1(S100A1)

Manufacturer	Cusabio
Category	Neuroscience Neural Lineage Markers Metabolism Cholesterol & Lipid Metabolism Targets for Rodent Neurosciences Peptides & Proteins Recombinant Proteins Neuronal Cell Markers
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	1mg
Host	E.coli
Item no.	CSB-EP020622HU-1
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Areas	Signal Transduction
Uniprot ID	P23297
Gene Names	S100A1
Organism	Homo sapiens (Human)
AA Sequence	GSELETAMETLINVFHAHSGKEGDKYKLSKKELKE LLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVD FQEYVVLVAALTVACNNFFWENS
Expression Region	2-94aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	26.4 kDa
Alternative Name(s)	S-100 protein alpha chain; S-100 protein subunit alpha; S100 calcium-binding protein A1
Relevance	Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer. Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites. May mediate calcium-dependent regulation on many physiological processes by interacting with other proteins, such as TPR-containing proteins, and modulating their activity.
Reference	S100 alpha, CAPL, and CACY molecular cloning and expression analysis of three calcium-binding proteins from human heart.Engelkamp D., Schaefer B.W., Erne P., Heizmann C.W.Biochemistry 31:10258-10264(1992)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Probably acts as a Ca(2+) signal transducer
Subcellular Location	Cytoplasm
Protein Families	S-100 family
Tissue Specificity	Highly prevalent in heart. Also found in lesser quantities in skeletal muscle and brain.
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP020622HU-1-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Request delivery time