« Back
Home /
Recombinant Mouse S-arrestin(Sag)

Recombinant Mouse S-arrestin(Sag)

Item no.	CSB-EP020669MOa0-200
Manufacturer	Cusabio
Amount	200 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Conjugate/Tag	HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	MAACGKTNKSHVIFKKVSRDKSVTIYLGKRDYVDH VSQVEPVDGVVLVDPELVKGKKVYVTLTCAFRYGQ EDIDVMGLTFRRDLYFSRVQVYPPVGAMSVLTQLQ ESLLKKLGDNTYPFLLTFPDYLPCSVMLQPAPQDV GKSCGVDFEVKAFASDITDPEEDKIPKKSSVRLLI RKVQHAPPEMGPQPSAEASWQFFMSDKPLNLSVSL SKEIYFHGEPIPVTVTVTNNTDKVVKKIKVSVEQI ANV
Protein Family	Arrestin family
Citations	"Deactivation of phosphorylated and nonphosphorylated rhodopsin by arrestin splice variants." Burns M.E., Mendez A., Chen C.K., Almuete A., Quillinan N., Simon M.I., Baylor D.A., Chen J. J. Neurosci. 26:1036-1044(2006)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	48 kDa protein (Retinal S-antigen) (S-AG) (Rod photoreceptor arrestin)
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	50.4 kDa
General Research Areas	Signal Transduction
Relevance	Binds to photoactivated, phosphorylated RHO and terminates RHO signaling via G-proteins by competing with G-proteins for the same binding site on RHO. May play a role in preventing light-dependent degeneration of retinal photoreceptor cells
Expression Region	1-403aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Binds to photoactivated, phosphorylated RHO and terminates RHO signaling via G-proteins by competing with G-proteins for the same binding site on RHO
Subcellular Location	Cell projection, cilium, photoreceptor outer segment, Membrane, Peripheral membrane protein
Tissue Specificity	Detected in retina (at protein level).
Gene Names	Sag
Sequence Info	Full Length
Organism	Mus musculus (Mouse)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP020669MOa0-200-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 200 ug

available

Delivery expected until 9/11/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer