Comparison

Recombinant Human SCAN domain-containing protein 1(SCAND1)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP020755HU-10
eClass 6.1 34160400
eClass 9.0 42020190
Available
AA Sequence
MAATEPILAATGSPAAVPPEKLEGAGSSSAPERNC VGSSLPEASPPAPEPSSPNAAVPEAIPTPRAAASA ALELPLGPAPVSVAPQAEAEARSTPGPAGSRLGPE TFRQRFRQFRYQDAAGPREAFRQLRELSRQWLRPD IRTKEQIVEMLVQEQLLAILPEAARARRIRRRTDV RITG
Research Topic
others
Uniprot ID
P57086
Gene Names
SCAND1
Tag Info
N-terminal GST-tagged
Expression Region
1-179aa
MW of Fusion Proten
46, 1
Sequence Info
Full Length
Relevance
May regulate transcriptional activity.
Reference
"The SCAN domain mediates selective oligomerization."
Schumacher C., Wang H., Honer C., Ding W., Koehn J., Lawrence Q., Coulis C.M., Wang L.L., Ballinger D., Bowen B.R., Wagner S.
J. Biol. Chem. 275:17173-17179(2000)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 10ug
Available: In stock
Listprice: €154.00
Price: €154.00
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close