Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
10ug |
Host |
E.coli |
Item no. |
CSB-EP020871MO-10 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Cell Biology |
Uniprot ID |
P31230 |
Gene Names |
Aimp1 |
Organism |
Mus musculus (Mouse) |
AA Sequence |
ATNDAVLKRLEQKGAEADQIIEYLKQQVALLKEKA ILQATMREEKKLRVENAKLKKEIEELKQELILAEI HNGVEQVRVRLSTPLQTNCTASESVVQSPSVATTA SPATKEQIKAGEEKKVKEKTEKKGEKKEKQQSAAA STDSKPIDASRLDLRIGCIVTAKKHPDADSLYVEE VDVGEAAPRTVVSGLVNHVPLEQMQNRMVVLLCNL KPAKMRGVLSQAMVMCASSPEKVEILAPPNGSVPG DRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNAE CVATYKGAPFEVKGKGVCRAQTMANSGIK |
Expression Region |
2-310aa |
Sequence Info |
Full Length of Mature Protein |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
49.9 kDa |
Alternative Name(s) |
Multisynthase complex auxiliary component p43 Cleaved into the following chain: Endothelial monocyte-activating polypeptide 2 Short name: EMAP-2 Alternative name(s): Endothelial monocyte-activating polypeptide II Short name: EMAP-II Small inducible cytokine subfamily E member 1 |
Relevance |
Non-catalytic component of the multisynthase complex. Stimulates the catalytic activity of Cytoplasmic domain arginyl-tRNA synthase. Binds tRNA. Possesses inflammatory cytokine activity. Negatively regulates TGF-beta signaling through stabilization of SMURF2 by binding to SMURF2 and inhibiting its SMAD7-mediated degradation. Involved in glucose homeostasis through induction of glucagon secretion at low glucose levels. Promotes dermal fibroblast proliferation and wound repair. Regulates KDELR1-mediated retention of HSP90B1/gp96 in the endoplasmic reticulum. Plays a role in angiogenesis by inducing endothelial cell migration at low concentrations and endothelian cell apoptosis at high concentrations. Induces maturation of dendritic cells and monocyte cell adhesion. Modulates endothelial cell responses by degrading HIF-1A through interaction with PSMA7 (By similarity). |
Reference |
"A tissue-specific atlas of mouse protein phosphorylation and expression."Huttlin E.L., Jedrychowski M.P., Elias J.E., Goswami T., Rad R., Beausoleil S.A., Villen J., Haas W., Sowa M.E., Gygi S.P.Cell 143:1174-1189(2010) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Non-catalytic component of the multisynthase complex |
Subcellular Location |
Nucleus, Cytoplasm, cytosol, Cytoplasmic vesicle, secretory vesicle, Secreted, Endoplasmic reticulum, Golgi apparatus |
Tissue Specificity |
Highly expressed in salivary glands and pancreatic alpha cells in the adult (at protein level) (PubMed:17001013). In the embryo, expressed primarily at sites of tissue remodeling such as ganglia, developing bones and teeth (PubMed:9770485). |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.