« Back
Home /
Recombinant Human Excitatory amino acid transporter 4(SLC1A6),partial

Recombinant Human Excitatory amino acid transporter 4(SLC1A6),partial

Item no.	CSB-EP021437HU-500
Manufacturer	Cusabio
Amount	500 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Food Safety Allergenes Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Host	E.coli
Conjugate/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MVTIIHPGKGSKEGLHREGRIETIPTADAFMDLIR NMFPPNLVEACFKQFKTQYSTRVVTRTMVRTENGS EPGASMPPPFSVENGTSFLENVTRALGTLQEMLSF EETVPVPGSANGINALGL
Protein Family	Dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family, SLC1A6 subfamily
Citations	"An excitatory amino-acid transporter with properties of a ligand-gated chloride channel."Fairman W.A., Vandenberg R.J., Arriza J.L., Kavanaugh M.P., Amara S.G.Nature 375:599-603(1995)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Sodium-dependent glutamate/aspartate transporter,Solute carrier family 1 member 6
Available
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	40.4 kDa
Buffer	Tris-based buffer, 50% glycerol
General Research Areas	Neuroscience
Relevance	Transports L-glutamate and also L- and D-aspartate. Seems to act as a symport by cotransporting sodium.
Expression Region	149-271aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Sodium-dependent, high-affinity amino acid transporter that mediates the uptake of L-glutamate and also L-aspartate and D-aspartate
Subcellular Location	Cell membrane, Multi-pass membrane protein
Tissue Specificity	Brain. Expressed densely and selectively in cell bodies of Purkinje cells.
Pathway	Glutamatergicsynapse
Gene Names	SLC1A6
Sequence Info	Partial
Organism	Homo sapiens (Human)
Manufacturer - Format	Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP021437HU-500-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500 ug

available

Delivery expected until 1/15/2026

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer