« Back
Home /
Recombinant human Sulfotransferase 1A3/1A4

Recombinant human Sulfotransferase 1A3/1A4

Item no.	CSB-EP022935HUe0-100
Manufacturer	Cusabio
Amount	100 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Conjugate/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQ ARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKC NRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLI KSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYY HFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQH VQEWWELSRTHPVLYLFYEDMKENPKREIQKILEF VGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQ ELM
Protein Family	Sulfotransferase 1 family
Citations	Identification of two human brain aryl sulfotransferase cDNAs. Zhu X., Veronese M.E., Bernard C.C., Sansom L.N., McManus M.E. Biochem. Biophys. Res. Commun. 195:120-127(1993)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Aryl sulfotransferase 1A3/1A4; Catecholamine-sulfating phenol sulfotransferase; HAST3; M-PST; Monoamine-sulfating phenol sulfotransferase; Placental estrogen sulfotransferase; Sulfotransferase 1A3/1A4; Sulfotransferase, monoamine-preferring; Thermolabile phenol sulfotransferase
Available
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	61.2 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas	Neuroscience
Relevance	Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of phenolic monoamines (neurotransmitters such as dopamine, norepinephrine and serotonin) and phenolic and catechol drugs.
Expression Region	1-295aa
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of phenolic monoamines (neurotransmitters such as dopamine, norepinephrine and serotonin) and phenolic and catechol drugs.
Subcellular Location	Cytoplasm
Tissue Specificity	Liver, colon, kidney, lung, brain, spleen, small intestine, placenta and leukocyte.
Gene Names	SULT1A3
Sequence Info	Full Length
Organism	Homo sapiens (Human)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP022935HUe0-100-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 8/28/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer