« Back
Home /
Recombinant Mouse Toll-like receptor 7(Tlr7),partial

Recombinant Mouse Toll-like receptor 7(Tlr7),partial

Item no.	CSB-EP023606MOb1-50
Manufacturer	Cusabio
Amount	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Neuroscience Neuroinflammation Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	Myc, HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	FRWFPKTLPCEVKVNIPEAHVIVDCTDKHLTEIPE GIPTNTTNLTLTINHIPSISPDSFRRLNHLEEIDL RCNCVPVLLGSKANVCTKRLQIRPGSFSGLSDLKA LYLDGNQLLEIPQDLPSSLHLLSLEANNIFSITKE NLTELVNIETLYLGQNCYYRNPCNVSYSIEKDAFL VMRNLKVLSLKDNNVTAVPTTLPPNLLELYLYNNI IKKIQENDFNNLNELQVLDLSGNCPRCYNVPYPCT PCE
Protein Family	Toll-like receptor family
Citations	"Innate antiviral responses by means of TLR7-mediated recognition of single-stranded RNA." Diebold S.S., Kaisho T., Hemmi H., Akira S., Reis e Sousa C. Science 303:1529-1531(2004)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Manufacturer - Targets	Tlr7
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	43.8 kDa
General Research Areas	Epigenetics and Nuclear Signaling
Relevance	Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific to microorganisms. TLR7 is a nucleotide-sensing TLR which is activated by single-stranded RNA. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.
Expression Region	27-348aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific to microorganisms. TLR7 is a nucleotide-sensing TLR which is activated by single-stranded RNA. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.
Subcellular Location	Endoplasmic reticulum membrane, Single-pass type I membrane protein, Endosome, Lysosome, Cytoplasmic vesicle, phagosome
Biologically active	Not Test
Protein length	Partial

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP023606MOb1-50-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 9/25/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer