Comparison

Recombinant Human Transmembrane protein 132A(TMEM132A),partial

Item no. CSB-EP023699HU-10
Manufacturer Cusabio
Amount 10 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Specific against other
Conjugate/Tag Myc, HIS
Purity Greater than 85% as determined by SDS-PAGE.
Sequence QPVMGISLTLSRGTAHPGEVTATCWAQSALPAPKQ EVALSLWLSFSDHTVAPAELYDRRDLGLSVSAEEP GAILPAEEQGAQLGVVVSGAGAEGLPLHVAL
Protein Family TMEM132 family
Citations "Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O.
DNA Res. 7:273-281(2000)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias HSPA5-binding protein 1,HSPA5BP1,KIAA1583
Available
Manufacturer - Conjugate / Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
17.4 kDa
Buffer
Tris-based buffer, 50% glycerol
Relevance
May play a role in embryonic and postnatal development of the brain. Increased resistance to cell death induced by serum starvation in cultured cells. Regulates cAMP-induced GFAP gene expression via STAT3 phosphorylation
Expression Region
642-742aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
May play a role in embryonic and postnatal development of the brain. Increased resistance to cell death induced by serum starvation in cultured cells. Regulates cAMP-induced GFAP gene expression via STAT3 phosphorylation (By similarity).
Subcellular Location
Golgi apparatus membrane, Single-pass type I membrane protein, Endoplasmic reticulum membrane, Single-pass type I membrane protein
Gene Names
TMEM132A
Sequence Info
Partial
Organism
Homo sapiens (Human)
Manufacturer - Format
Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close