Comparison

Recombinant Mouse Tumor necrosis factor ligand superfamily member 11(Tnfsf11),partial

Manufacturer Cusabio
Category
Type Proteins Recombinant
Specific against other
Format Liquid or Lyophilized powder
Amount 50ug
Host E.coli
Item no. CSB-EP023986MO-50
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research areas
Others
Target / Protein
Tnfsf11
Biologically active
Not Test
Expression system
E.coli
Species of origin
Mus musculus (Mouse)
Uniprot ID
O35235
AA Sequence
YFRAQMDPNRISEDSTHCFYRILRLHENADLQDST LESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRF SGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASI PSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQ DGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKT SIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGF FKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQD ID
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
70-316aa
Protein length
Extracellular Domain
MW
43.9 kDa
Alternative Name(s)
Osteoclast differentiation factor
Short name:ODF
Osteoprotegerin ligand
Short name:OPGL
Receptor activator of nuclear factor kappa-B ligand
Short name:RANKL
TNF-related activation-induced cytokine
Short name:TRANCE
CD_antigen: CD254
Relevance
Cytokine that binds to TNFRSF11B/OPG and to TNFRSF11A/RANK. Osteoclast differentiation and activation factor. Augments the ability of dendritic cells to stimulate naive T-cell proliferation. May be an important regulator of interactions between T-cells and dendritic cells and may play a role in the regulation of the T-cell-dependent immune response. May also play an important role in enhanced bone-resorption in humoral hypercalcemia of malignancy.
References
"TRANCE is a novel ligand of the tumor necrosis factor receptor family that activates c-Jun N-terminal kinase in T cells."Wong B.R., Rho J., Arron J., Robinson E., Orlinick J., Chao M., Kalachikov S., Cayani E., Bartlett F.S. III, Frankel W.N., Lee S.Y., Choi Y.J. Biol. Chem. 272:25190-25194(1997)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Cytokine that binds to TNFRSF11B/OPG and to TNFRSF11A/RANK. Osteoclast differentiation and activation factor. Augments the ability of dendritic cells to stimulate naive T-cell proliferation. May be an important regulator of interactions between T-cells and dendritic cells and may play a role in the regulation of the T-cell-dependent immune response. May also play an important role in enhanced bone-resorption in humoral hypercalcemia of malignancy (By similarity). Induces osteoclastogenesis by activating multiple signaling pathways in osteoclast precursor cells, chief among which is induction of long lasting oscillations in the intracellular concentration of Ca (2+) resulting in the activation of NFATC1, which translocates to the nucleus and induces osteoclast-specific gene transcription to allow differentiation of osteoclasts
Involvement in disease
Deficiency in Tnfsf11 results in failure to form lobulo-alveolar mammary structures during pregnancy, resulting in death of newborns. Trance-deficient mice show severe osteopetrosis, with no osteoclasts, marrow spaces, or tooth eruption, and exhibit profound growth retardation at several skeletal sites, including the limbs, skull, and vertebrae and have marked chondrodysplasia, with thick, irregular growth plates and a relative increase in hypertrophic chondrocytes.
Subcellular Location
Isoform 1: Cell membrane, Single-pass type II membrane protein, SUBCELLULAR LOCATION: Isoform 2: Cell membrane, Single-pass type II membrane protein, SUBCELLULAR LOCATION: Isoform 3: Cytoplasm, SUBCELLULAR LOCATION: Tumor necrosis factor ligand superfamily member 11, soluble form: Secreted
Protein Families
Tumor necrosis factor family
Tissue Specificity
Highly expressed in thymus and lymph nodes, but not in non-lymphoid tissues and is abundantly expressed in T-cells but not in B-cells. A high level expression is also seen in the trabecular bone and lung.
Tag Information
N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close