« Back
Home /
Recombinant Human Mitochondrial import receptor subunit TOM40 homolog(TOMM40)

Recombinant Human Mitochondrial import receptor subunit TOM40 homolog(TOMM40)

Item no.	CSB-EP024050HU-100
Manufacturer	Cusabio
Amount	100 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Neuroscience Protein Aggregation, Clearance & Misfolding Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGF TLPPLGGSLGAGTSTSRSSERTPGAATASASGAAE DGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTV NKGLSNHFQVNHTVALSTIGESNYHFGVTYVGTKQ LSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSK MAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGNPDV LVGSGILVAHYLQSITPCLALGGELVYHRRPGEEG TVM
Protein Family	Tom40 family
Citations	Sequencing of 42kb of the APO E-C2 gene cluster reveals a new gene: PEREC1. Freitas E.M., Zhang W.J., Lalonde J.P., Tay G.K., Gaudieri S., Ashworth L.K., Van Bockxmeer F.M., Dawkins R.L. DNA Seq. 9:89-100(1998)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Protein Haymaker; Translocase of outer membrane 40KDA subunit homolog; p38.5
Available
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	64.9 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas	Tags & Cell Markers
Relevance	Channel-forming protein essential for import of protein precursors into mitochondria.By similarity1 Publication
Expression Region	1-361aa
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Channel-forming protein essential for import of protein precursors into mitochondria.
Subcellular Location	Mitochondrion outer membrane, Multi-pass membrane protein
Gene Names	TOMM40
Sequence Info	Full Length
Organism	Homo sapiens (Human)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP024050HU-100-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 8/28/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer