« Back
Home /
Recombinant Mouse Ventricular zone-expressed PH domain-containing protein 1(Veph1),partial

Recombinant Mouse Ventricular zone-expressed PH domain-containing protein 1(Veph1),partial

Item no.	CSB-EP025844MO-10
Manufacturer	Cusabio
Amount	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Conjugate/Tag	Myc, HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	AMTESTFPQQKDLEQLQLHLEEVRFFDVFGFSETA GAWQCFMCNNPEKATVVNQDGQPLIEGKLKEKQVR WKFIKRWKTHYFTLAGNQLLFQKGKSKDDPDDSPI ELSKVQSVKAVAKKRRDRSLPRAFEIFTDSKTYVF KAKDEKNAEEWLQCINVALAQAKERESREVTTYL
Protein Family	MELT/VEPH family
Citations	"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Protein melted homolog (Veph)
Available
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	27.7 kDa
Relevance	Interacts with TGF-beta receptor type-1 (TGFBR1) and inhibits dissociation of activated SMAD2 from TGFBR1, impeding its nuclear accumulation and resulting in impaired TGF-beta signaling. May also affect FOXO, Hippo and Wnt signaling.
Expression Region	660-833aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Interacts with TGF-beta receptor type-1 (TGFBR1) and inhibits dissociation of activated SMAD2 from TGFBR1, impeding its nuclear accumulation and resulting in impaired TGF-beta signaling. May also affect FOXO, Hippo and Wnt signaling.
Subcellular Location	Cell membrane, Peripheral membrane protein, Cytoplasmic side
Tissue Specificity	Specifically expressed in kidney and eye. In the eye, expressed in retinal pigmented epithelium but not in the neural retina.
Gene Names	Veph1
Sequence Info	Partial
Organism	Mus musculus (Mouse)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP025844MO-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 9/4/2025

Compare

Add to wishlist

Get an offer

Request delivery time