« Back
Home /
Recombinant Human Epithelial cell adhesion molecule(EPCAM),partial

Recombinant Human Epithelial cell adhesion molecule(EPCAM),partial

Manufacturer	Cusabio
Category	Oncology Metabolism Glucose Homeostasis Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins By Organ Lung Cancer
Type	Proteins Recombinant
Specific against	other
Amount	100ug
Host	E.coli
Item no.	CSB-EP1079HU(F)-100
eClass 6.1	34160400
eClass 9.0	42020190
Available
Alternative Name(s)	Adenocarcinoma-associated antigen Cell surface glycoprotein Trop-1 Epithelial cell surface antigen Epithelial glycoprotein Short name: EGP Epithelial glycoprotein 314 Short name: EGP314 Short name: hEGP314 KS 1/4 antigen KSA Major gastrointestinal tumor-associated protein GA733-2 Tumor-associated calcium signal transducer 1 CD_antigen: CD326
AA Sequence	QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVI CSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDG LYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTD KDTEITCSERVRTYWIIIELKHKAREKPYDSKSLR TALQKEITTRYQLDPKFITSILYENNVITIDLVQN SSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDL TVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK
Research Topic	Tags & Cell Markers
Uniprot ID	P16422
Gene Names	EPCAM
Tag Info	N-terminal 6xHis-SUMO-tagged
Expression Region	24-265aa
MW of Fusion Proten	43, 4
Sequence Info	Partial
Relevance	May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E.
Reference	"Molecular cloning and characterization of a human adenocarcinoma/epithelial cell surface antigen complementary DNA."Strnad J., Hamilton A.E., Beavers L.S., Gamboa G.C., Apelgren L.D., Taber L.D., Sportsman J.R., Bumol T.F., Sharp J.D., Gadski R.A.Cancer Res. 49:314-317(1989)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species	Homo sapiens (Human)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Request delivery time