« Back
Home /
Recombinant Human LIM and senescent cell antigen-like-containing domain protein 1(LIMS1)

Recombinant Human LIM and senescent cell antigen-like-containing domain protein 1(LIMS1)

Item no.	CSB-EP232922HU-50
Manufacturer	Cusabio
Amount	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MANALASATCERCKGGFAPAEKIVNSNGELYHEQC FVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC CHQCGEFTIGRVIKAMNNSWHPECFRCDLCQEVLA DIGFVKNAGRHLCRPCHNREKARGLGKYICQKCHA IIDEQPLIFKNDPYHPDHFNCANCGKELTADAREL KGELYCLPCHDKMGVPICGACRRPIEGRVVNAMGK QWHVEHFVCAKCEKPFLGHRHYERKGLAYCETHYN QLF
Citations	"A new LIM protein containing an autoepitope homologous to 'senescent cell antigen'." Rearden A. Biochem. Biophys. Res. Commun. 201:1124-1131(1994)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Particularly interesting new Cys-His protein 1
Available
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	64.2 kDa
General Research Areas	Cardiovascular
Relevance	Adapter protein in a cytoplasmic complex linking beta-integrins to the actin cytoskeleton, bridges the complex to cell surface receptor tyrosine kinases and growth factor receptors. Involved in the regulation of cell survival, cell proliferation and cell differentiation.
Expression Region	1-325aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Adapter protein in a cytoplasmic complex linking beta-integrins to the actin cytoskeleton, bridges the complex to cell surface receptor tyrosine kinases and growth factor receptors. Involved in the regulation of cell survival, cell proliferation and cell differentiation.
Subcellular Location	Cell junction, focal adhesion, Cell membrane, Peripheral membrane protein, Cytoplasmic side
Tissue Specificity	Expressed in most tissues except in the brain.
Gene Names	LIMS1
Sequence Info	Full Length of BC005341
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP232922HU-50-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 9/4/2025

Compare

Add to wishlist

Get an offer

Request delivery time