Comparison

Recombinant Enterobacteria phage M13 Tail virion protein G9P(IX)

Item no. CSB-EP301675ECY-500
Manufacturer Cusabio
Amount 500 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host E.coli
Conjugate/Tag SUMO, HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MSVLVYSFASFVLGWCLRSGITYFTRLMETSS
Protein Family Inovirus G9P protein family
Citations "Nucleotide sequence of the filamentous bacteriophage M13 DNA genome: comparison with phage fd."van Wezenbeek P.M.G.F., Hulsebos T.J.M., Schoenmakers J.G.G.Gene 11:129-148(1980)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Coat protein C, polypeptide II; G9P
Available
Manufacturer - Conjugate / Tag
N-terminal 6xHis-SUMO-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
19.7 kDa
General Research Areas
Microbiology
Relevance
May initiate with G7P the virion concomitant assembly-budding process, by interacting with the packaging signal of the viral genome. The assembly-budding takes place at the host inner membrane. In turn, G7P and G9P are present at the end of the filamentous virion that emerges first from the bacterial host.
Expression Region
1-32aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
May initiate with G7P the virion concomitant assembly-budding process, by interacting with the packaging signal of the viral genome. The assembly-budding takes place at the host inner membrane. In turn, G7P and G9P are present at the end of the filamentous virion that emerges first from the bacterial host.
Subcellular Location
Virion, Host membrane, Single-pass membrane protein
Gene Names
IX
Sequence Info
Full Length
Organism
Enterobacteria phage M13 (Bacteriophage M13)
Storage Buffer
Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 500 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close