« Back
Home /
Recombinant Escherichia coli Glutamate-pyruvate aminotransferase AlaC(alaC)

Recombinant Escherichia coli Glutamate-pyruvate aminotransferase AlaC(alaC)

Item no.	CSB-EP302867ENV-10
Manufacturer	Cusabio
Amount	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MADTRPERRFTRIDRLPPYVFNITAELKMAARRRG EDIIDFSMGNPDGATPPHIVEKLCTVAQRPDTHGY STSRGIPRLRRAISRWYQDRYDVEIDPESEAIVTI GSKEGLAHLMLATLDHGDTVLVPNPSYPIHIYGAV IAGAQVRSVPLVEGVDFFNELERAIRESYPKPKMM ILGFPSNPTAQCVELEFFEKVVALAKRYDVLVVHD LAYADIVYDGWKAPSIMQVPGARDVAVEFFTLSKS YNM
Protein Family	Class-I pyridoxal-phosphate-dependent aminotransferase family
Citations	Isolation of a mutant auxotrophic for L-alanine and identification of three major aminotransferases that synthesize L-alanine in Escherichia coli.Yoneyama H., Hori H., Lim S.J., Murata T., Ando T., Isogai E., Katsumata R.Biosci. Biotechnol. Biochem. 75:930-938(2011)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	62.2 kDa
Relevance	Involved in the biosynthesis of alanine.
Expression Region	1-412aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Involved in the biosynthesis of alanine.
Subcellular Location	Cytoplasm
Gene Names	alaC
Sequence Info	Full Length
Organism	Escherichia coli (strain K12)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP302867ENV-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 8/28/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer