« Back
Home /
Recombinant Mycoplasma pneumoniae Putative Xaa-Pro aminopeptidase(pepP)

Recombinant Mycoplasma pneumoniae Putative Xaa-Pro aminopeptidase(pepP)

Manufacturer	Cusabio
Category	Neuroscience Aging & Neurological Disorders Protein Aggregation, Clearance & Misfolding Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	200ug
Host	E.coli
Item no.	CSB-EP303407MLW-200
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Microbiology
Uniprot ID	P75313
Gene Names	pepP
Organism	Mycoplasma pneumoniae (strain ATCC 29342 / M129)
AA Sequence	MHNELQQKLAVLHKLLQDNKADAILIGSDQNRFWL TGFPSSAGWLVVHKQRVNLFIDGRYFEAAKTAIDP LVKVELFTTYKQVKALCEQVGVKHLLIEGDYLTFN YQNFIKELCAQYTVINAQEIRRQKLPSEILAIEKV VEITRKVAVKLKRFIQPGMTELFIAQWITDQLVKA GGAKNSFDPIVATGKNGANPHHKPSKLKVKSGDFV TCDFGTIYNGYCSDITRTFLVGKKPNNEVLLKAYK KVDEANMAGINAANTQLTGAEVDKVCRDIIEASEF KDYFVHSTGHGVGLDIHEMPNVSTSYNKLLCENAV ITIEPGIYIPSVGGIRIEDMVLVKDHKSVWLSAKI PRAF
Expression Region	1-354aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	55.6 kDa
Alternative Name(s)	Short name: X-Pro aminopeptidase Alternative name(s): Aminoacylproline aminopeptidase Aminopeptidase P Short name: APP
Reference	"Complete sequence analysis of the genome of the bacterium Mycoplasma pneumoniae."Himmelreich R., Hilbert H., Plagens H., Pirkl E., Li B.-C., Herrmann R.Nucleic Acids Res. 24:4420-4449(1996) .
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Protein Families	Peptidase M24B family
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200ug

available

Request delivery time