Comparison

Recombinant Chlamydia trachomatis 60KDA chaperonin(groL)

Item no. CSB-EP314770DSB-100
Manufacturer Cusabio
Amount 100 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host E.coli
Conjugate/Tag SUMO, HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence VAKNIKYNEEARKKIQKGVKTLAEAVKVTLGPKGR HVVIDKSFGSPQVTKDGVTVAKEVELADKHENMGA QMVKEVASKTADKAGDGTTTATVLAEAIYTEGLRN VTAGANPMDLKRGIDKAVKVVVDQIRKISKPVQHH KEIAQVATISANNDAEIGNLIAEAMEKVGKNGSIT VEEAKGFETVLDIVEGMNFNRGYLSSYFATNPETQ ECVLEDALVLIYDKKISGIKDFLPVLQQVAESGRP LLI
Protein Family Chaperonin (HSP60) family
Citations Genome sequence of an obligate intracellular pathogen of humans: Chlamydia trachomatis.Stephens R.S., Kalman S., Lammel C.J., Fan J., Marathe R., Aravind L., Mitchell W.P., Olinger L., Tatusov R.L., Zhao Q., Koonin E.V., Davis R.W.Science 282:754-759(1998)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias 57KDA chlamydial hypersensitivity antigen; GroEL protein; Heat shock protein 60; HSP60; Protein Cpn60
Available
Manufacturer - Targets
groL
Manufacturer - Conjugate / Tag
N-terminal 6xHis-SUMO-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
74.0 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas
Microbiology
Relevance
Prevents misfolding and promotes the refolding and proper assembly of unfolded polypeptides generated under stress conditions (By similarity). This protein is implicated in the pathogenesis of chlamydial disease. Inflammation elicited by the 57KDA antigen may damage tissue, with progression to scarring of conjunctival and fallopian tube mucosae, which respectively result in blindness and infertility.
Biologically Active
Not Test
Expression Region
2-544aa
Protein Length
Full Length of Mature Protein
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Prevents misfolding and promotes the refolding and proper assembly of unfolded polypeptides generated under stress conditions (By similarity). This protein is implicated in the pathogenesis of chlamydial disease. Inflammation elicited by the 57 kDa antigen may damage tissue, with progression to scarring of conjunctival and fallopian tube mucosae, which respectively result in blindness and infertility.
Subcellular Location
Cytoplasm

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close