« Back
Home /
Recombinant Human herpesvirus 1 Envelope glycoprotein B(gB),partial

Recombinant Human herpesvirus 1 Envelope glycoprotein B(gB),partial

Item no.	CSB-EP318023HWY-10
Manufacturer	Cusabio
Amount	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Conjugate/Tag	Myc, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	APSSPGTPGVAAATQAANGGPATPAPPAPGAPPTG DPKPKKNRKPKPPKPPRPAGDNATVAAGHATLREH LRDIKAENTDANFYVCPPPTGATVVQFEQPRRCPT RPEGQNYTEGIAVVFKENIAPYKFKATMYYKDVTV SQVWFGHRYSQFMGIFEDRAPVPFEEVIDKINAKG VCRSTAKYVRNNLETTAFHRDDHETDMELKPANAA TRTSRGWHTTDLKYNPSRVEAFHRYGTTVNCIVEE VDA
Protein Family	Herpesviridae glycoprotein B family
Citations	"Herpes simplex virus type 1 gK is required for gB-mediated virus-induced cell fusion, while neither gB and gK nor gB and UL20p function redundantly in virion de-envelopment." Melancon J.M., Luna R.E., Foster T.P., Kousoulas K.G. J. Virol. 79:299-313(2005)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	34.9 kDa
Relevance	Envelope glycoprotein that forms spikes at the surface of virion envelope. Essential for the initial attachment to heparan sulfate moities of the host cell surface proteoglycans. Involved in fusion of viral and cellular membranes leading to virus entry into the host cell. Following initial binding to its host receptors, membrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL. May be involved in the fusion between the virion envelope and the outer nuclear membrane during virion egress. Also plays a role, together with gK, in virus-induced cell-to-cell fusion
Expression Region	31-248aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Envelope glycoprotein that forms spikes at the surface of virion envelope. Essential for the initial attachment to heparan sulfate moities of the host cell surface proteoglycans. Involved in fusion of viral and cellular membranes leading to virus entry into the host cell. Following initial binding to its host receptors, membrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL. May be involved in the fusion between the virion envelope and the outer nuclear membrane during virion egress (By similarity). Also plays a role, together with gK, in virus-induced cell-to-cell fusion (syncytia formation).
Subcellular Location	Virion membrane, Single-pass type I membrane protein, Host cell membrane, Single-pass type I membrane protein, Host endosome membrane, Single-pass type I membrane protein, Host Golgi apparatus membrane, Single-pass type I membrane protein
Gene Names	gB
Sequence Info	Partial
Organism	Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP318023HWY-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 9/25/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer