Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
10ug |
Host |
E.coli |
Item no. |
CSB-EP326235DBI-10 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Others |
Uniprot ID |
P25687 |
Gene Names |
N/A |
Organism |
Dendroaspis polylepis polylepis (Black mamba) |
AA Sequence |
AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVG TSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQT SPKKFKCLSKS |
Expression Region |
1-81aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
24.6 kDa |
Alternative Name(s) |
Short name: MIT 1 Alternative name(s): Black mamba intestinal toxin 1 Black mamba venom protein A |
Relevance |
Potently contracts gastrointestinal (GI) smooth muscle. The receptor for this toxin is present both in the CNS and in the smooth muscle and may be a potassium channel. |
Reference |
"MIT1, a black mamba toxin with a new and highly potent activity on intestinal contraction."Schweitz H., Pascaud P., Diochot S., Moinier D., Lazdunski M.FEBS Lett. 461:183-188(1999) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Potent agonist for both PKR1/PROKR1 and PKR2/PROKR2 |
Subcellular Location |
Secreted |
Protein Families |
AVIT (prokineticin) family |
Tissue Specificity |
Expressed by the venom gland. |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.