« Back
Home /
Recombinant Staphylococcus aureus Autolysin(lytA)

Recombinant Staphylococcus aureus Autolysin(lytA)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	100ug
Item no.	CSB-EP326479FKZ-100
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Areas	Others
Uniprot ID	P24556
Gene Names	lytA
Organism	Staphylococcus aureus
AA Sequence	MQAKLTKNEFIERLKTSEGKQFNVDLWYGFQCFDY ANAGWKVLFGLLLKGLGAKDIPFANNFDGLATVYQ NTPDFLAQPGDMVVFGSNYGAGYGHVAWVIEATLD YIIVYEQNWLGGGWTDGIEQPAGVGKKLQDDNMLM ISLCGLSVRILKVRQRHDQFNLLHKHPKKETAKPQ PKAVELKIIKDVVKGYDLPKRGSNPKGIVIHNDAG SKGATAEAYRNGLVNAPLSRLEAGIAHSYVSGNTV WQALDESQVGWHTANQIGNKYYYGIEVCQSMGADN ATFLKNEQATFQECARLLKKWGLPANRNTIRLHNE FTSTSCPHRSSVLHTGFDPVTRGLLPEDKRLQLKD YFIKQIRAYMDGKIPVATVSNESSASSNTVKPVAS AWKRNKYGTYYMEESARFTNGNQPITVRKVGPFLS CPVGYQFQPGGYCDYTEVMLQDGHVWVGYTWEGQR YYLPIRTWNGSAPPNQILGDLWGEIS
Expression Region	1-481aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	57.8 kDa
Alternative Name(s)	N-acetylmuramoyl-L-alanine amidase
Relevance	Autolysins are involved in some important biological processes such as cell separation, cell-wall turnover, competence for genetic transformation, formation of the flagella and sporulation. Autolysin strictly depends on the presence of choline-containing cell walls for activity.
Reference	Sequence analysis of a Staphylococcus aureus gene encoding a peptidoglycan hydrolase activity. Wang X., Wilkinson B.J., Jayaswal R.K. Gene 102:105-109(1991)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Autolysins are involved in some important biological processes such as cell separation, cell-wall turnover, competence for genetic transformation, formation of the flagella and sporulation. Autolysin strictly depends on the presence of choline-containing cell walls for activity.
Subcellular Location	Secreted
Protein Families	N-acetylmuramoyl-L-alanine amidase 2 family
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Request delivery time