Comparison

Recombinant Glycine max Ribulose bisphosphate carboxylase large chain(rbcL)

Item no. CSB-EP328678GGV-100
Manufacturer Cusabio
Amount 100 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Specific against other
Host E.coli
Conjugate/Tag SUMO, HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence PQTETKASVGFKAGVKDYKLTYYTPDYETKDTDIL AAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTD GLTSLDRYKGRCYGLEPVAGEENQYIAYVAYPLDL FEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPT AYIKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPK LGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFM RWRDRFLFCAEAIFKSQAETGEIKGHYLNATAGTC EEM
Protein Family RuBisCO large chain family, Type I subfamily
Citations Complete chloroplast genome sequence of Glycine max and comparative analyses with other legume genomes.Saski C., Lee S.-B., Daniell H., Wood T.C., Tomkins J., Kim H.-G., Jansen R.K.Plant Mol. Biol. 59:309-322(2005).
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias RuBisCO large subunit
Available
Manufacturer - Targets
rbcL
Manufacturer - Conjugate / Tag
N-terminal 6xHis-SUMO-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
68.4 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas
Signal Transduction
Relevance
RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1, 5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate in the photorespiration process. Both reactions occur simultaneously and in competition at the same active site.
Expression Region
3-475aa
Protein Length
Full Length of Mature Protein
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
RuBisCO catalyzes two reactions
Subcellular Location
Plastid, chloroplast
Biological activity
Not Test
Manufacturer - Format
Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close