« Back
Home /
Recombinant Arachis hypogaea Allergen Ara h 1, clone P17

Recombinant Arachis hypogaea Allergen Ara h 1, clone P17

Item no.	CSB-EP331779ANE(A4)-500
Manufacturer	Cusabio
Amount	500 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Food Safety Allergenes Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Host	E.coli
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	KSPYRKTENPCAQRCLQSCQQEPDDLKQKACESRC TKLEYDPRCVYDTGATNQRHPPGERTRGRQPGDYD DDRRQPRREEGGRWGPAEPREREREEDWRQPREDW RRPSHQQPRKIRPEGREGEQEWGTPGSEVREETSR NNPFYFPSRRFSTRYGNQNGRIRVLQRFDQRSKQF QNLQNHRIVQIEARPNTLVLPKHADADNILVIQQG QATVTVANGNNRKSFNLDEGHALRIPSGFISYILN RHD
Protein Family	7S seed storage protein family
Citations	"N-glycan analysis by matrix-assisted laser desorption/ionization mass spectrometry of electrophoretically separated nonmammalian proteins: application to peanut allergen Ara h 1 and olive pollen allergen Ole e 1."Kolarich D., Altmann F.Anal. Biochem. 285:64-75(2000)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Allergen Ara h I
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	71.7 kDa
General Research Areas	Allergen
Expression Region	26-614aa
Protein Length	Full Length of Mature Protein
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Biological activity	Not Test
Manufacturer - Format	Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 500 ug

available

Delivery expected until 1/15/2026

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer