« Back
Home /
Recombinant Clostridium acetobutylicum Butyrate--acetoacetate CoA-transferase subunit B(ctfB)

Recombinant Clostridium acetobutylicum Butyrate--acetoacetate CoA-transferase subunit B(ctfB)

Item no.	CSB-EP332931DUB-50
Manufacturer	Cusabio
Amount	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Host	E.coli
Conjugate/Tag	Myc, HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	MINDKNLAKEIIAKRVARELKNGQLVNLGVGLPTM VADYIPKNFKITFQSENGIVGMGASPKINEADKDV VNAGGDYTTVLPDGTFFDSSVSFSLIRGGHVDVTV LGALQVDEKGNIANWIVPGKMLSGMGGAMDLVNGA KKVIIAMRHTNKGQPKILKKCTLPLTAKSQANLIV TELGVIEVINDGLLLTEINKNTTIDEIRSLTAADL LISNELRPMAV
Protein Family	3-oxoacid CoA-transferase subunit B family
Citations	"Cloning and expression of Clostridium acetobutylicum ATCC 824 acetoacetyl-coenzyme A:acetate/butyrate:coenzyme A-transferase in Escherichia coli." Cary J.W., Petersen D.J., Papoutsakis E.T., Bennett G.N. Appl. Environ. Microbiol. 56:1576-1583(1990)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Acetoacetyl-CoA:acetate/butyrate CoA-transferase subunit B (Coat B)
Available
Manufacturer - Targets	ctfB
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	30.6 kDa
General Research Areas	Epigenetics and Nuclear Signaling
Relevance	Involved in solventogenic switch which allows C.acetobutylicum to uptake acid and produce solvents. Acts mainly to detoxify the medium by removing the acetate and butyrate excreted earlier in the fermentation.
Expression Region	1-221aa
Protein Length	Full Length
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Involved in solventogenic switch which allows C.acetobutylicum to uptake acid and produce solvents. Acts mainly to detoxify the medium by removing the acetate and butyrate excreted earlier in the fermentation.
Biological activity	Not Test
Manufacturer - Format	Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP332931DUB-50-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 11/13/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer