« Back
Home /
Recombinant Bacillus subtilis Penicillin-binding protein 4(pbpE)

Recombinant Bacillus subtilis Penicillin-binding protein 4(pbpE)

Manufacturer	Cusabio
Category	Food Safety Antibiotics Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	500ug
Host	E.coli
Item no.	CSB-EP333755BRJ-500
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research areas	Microbiology
Target / Protein	pbpE
Biologically active	Not Test
Expression system	E.coli
Species of origin	Bacillus subtilis (strain 168)
Uniprot ID	P32959
AA Sequence	MKQNKRKHLQTLFETLGEKHQFNGTVLAAEGGDIL YHHSFGYAEMTEKRPLKTNSLFELASLSKPFTALG IILLEEKGILGYEDKVDRWLPGFPYQGVTIRHLLN HTSGLPDYMGWFFANWDSHKIAVNQDIVDMLMNEG LSGYFEPNEGWMYSNTGYVLLAVIIEKASGMSYAD FIKTSIFLPAGMNETRVYNRRLSPERIDHYAYGYV YDVHSETYVLPDELEETNYVVYLDGIQGDGTVNSV TSDLFRFDQALYQDDFISKASKESAFSPVRLNNGE TIDYGFGWVLQNSPEKGRIVSHSGGWPGYSTMMIR YIDHRKTLIYLSNKEEDTEYEQAILKAAEHILFGQ PYDVPERPADKKKKAIDTAIYSRYVGSYLLQDGTA AQVTTENERLYLEIAGQLRLELFPSSETRFFLRAL SVEVEFTLGEDAAKSFILYEDGSEEEAVRTK
Tag Info	N-terminal 6xHis-SUMO-tagged
Expression Region	1-451aa
Protein length	Full Length
MW	67.4 kDa
Alternative Name(s)	PBP 4* Alternative name(s): PBP 4A Penicillin-binding protein E
Relevance	Probably involved in peptidoglycan modification during cortex synthesis.
References	"The complete genome sequence of the Gram-positive bacterium Bacillus subtilis."Kunst F., Ogasawara N., Moszer I., Albertini A.M., Alloni G., Azevedo V., Bertero M.G., Bessieres P., Bolotin A., Borchert S., Borriss R., Boursier L., Brans A., Braun M., Brignell S.C., Bron S., Brouillet S., Bruschi C.V. Danchin A.Nature 390:249-256(1997).
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Probably involved in peptidoglycan modification during cortex synthesis.
Subcellular Location	Cell membrane, Peripheral membrane protein
Protein Families	Beta-lactamase family
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 500ug

available

Request delivery time