« Back
Home /
Recombinant Raphanus sativus Defensin-like protein 2(AFP2)

Recombinant Raphanus sativus Defensin-like protein 2(AFP2)

Manufacturer	Cusabio
Category	Oncology Peptides & Proteins Recombinant Proteins By Organ Lung Cancer Testicular & Prostate Cancer Hepatic Cancer
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	200ug
Host	E.coli
Item no.	CSB-EP339081RJP-200
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research areas	Others
Target / Protein	AFP2
Biologically active	Not Test
Expression system	E.coli
Species of origin	Raphanus sativus (Radish)
Uniprot ID	P30230
AA Sequence	QKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGS CNYVFPAHKCICYFPC
Tag Info	N-terminal 6xHis-SUMO-tagged
Expression Region	30-80aa
Protein length	Full Length of Mature Protein
MW	21.7 kDa
Alternative Name(s)	Cysteine-rich antifungal protein 2 Short name: AFP2 Short name: RAFP2
Relevance	Possesses antifungal activity sensitive to inorganic cations. Induces potential changes in fungal membranes and increased K+ efflux and Ca2+ uptake.
References	"Mutational analysis of a plant defensin from radish (Raphanus sativus L.) reveals two adjacent sites important for antifungal activity." De Samblanx G.W., Goderis I.J., Thevissen K., Raemaekers R., Fant F., Borremans F., Acland D.P., Osborn R.W., Patel S., Broekaert W.F. J. Biol. Chem. 272:1171-1179(1997).
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Possesses antifungal activity sensitive to inorganic cations. Induces potential changes in fungal membranes and increased K(+) efflux and Ca(2+) uptake.
Subcellular Location	Secreted
Protein Families	DEFL family
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200ug

available

Request delivery time