« Back
Home /
Recombinant Human GMP reductase 1(GMPR)

Recombinant Human GMP reductase 1(GMPR)

Item no.	CSB-EP339756HU-10
Manufacturer	Cusabio
Amount	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Host	E.coli
Conjugate/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERT FTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQH SMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGS GQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVE FVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADI IKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAH GLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMF SGH
Protein Family	IMPDH/GMPR family, GuaC type 1 subfamily
Citations	Two structural genes on different chromosomes are required for encoding the major subunit of human red cell glucose-6-phosphate dehydrogenase.Kanno H., Huang I.Y., Kan Y.W., Yoshida A.Cell 58:595-606(1989)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Guanosine 5'-monophosphate oxidoreductase 1 ,Guanosine monophosphate reductase 1
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	53.4 kDa
Buffer	Tris-based buffer, 50% glycerol
General Research Areas	Cell Biology
Relevance	Catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. It functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and in maintaining the intracellular balance of A and G nucleotides.
Expression Region	1-345aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. It functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and in maintaining the intracellular balance of A and G nucleotides.
Gene Names	GMPR
Sequence Info	Full Length
Organism	Homo sapiens (Human)
Manufacturer - Format	Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP339756HU-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 11/13/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer