Comparison

Recombinant Epstein-Barr virus Trans-activator protein BZLF1 (BZLF1)

Item no. CSB-EP355980EFA-50
Manufacturer Cusabio
Amount 50 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host E.coli
Conjugate/Tag SUMO, HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MMDPNSTSEDVKFTPDPYQVPFVQAFDQATRVYQD LGGPSQAPLPCVLWPVLPEPLPQGQLTAYHVSTAP TGSWFSAPQPAPENAYQAYAAPQLFPVSDITQNQQ TNQAGGEAPQPGDNSTVQTAAAVVFACPGANQGQQ LADIGVPQPAPVAAPARRTRKPQQPESLEECDSEL EIKRYKNRVASRKCRAKFKQLLQHYREVAAAKSSE NDRLRLLLKQMCPSLDVDSIIPRTPDVLHEDLLNF
Protein Family BZIP family
Citations TORC2, a coactivator of cAMP-response element-binding protein, promotes Epstein-Barr virus reactivation from latency through interaction with viral BZLF1 protein.Murata T., Sato Y., Nakayama S., Kudoh A., Iwahori S., Isomura H., Tajima M., Hishiki T., Ohshima T., Hijikata M., Shimotohno K., Tsurumi T.J. Biol. Chem. 284:8033-8041(2009)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Zebra
Available
Manufacturer - Targets
BZLF1
Manufacturer - Conjugate / Tag
N-terminal 6xHis-SUMO-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
42.9 kDa
Relevance
Plays a key role in the switch from latent infection to lytic cycle producing new virions. Acts as a transcription factor, inducing early lytic cycle genes, and as a origin binding protein for genome replication. BZLF1 activates the promoter of another EBV gene (BSLF2+BMLF1).
Expression Region
1-245aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Plays a key role in the switch from latent infection to lytic cycle producing new virions. Acts as a transcription factor, inducing early lytic cycle genes, and as a origin binding protein for genome replication. BZLF1 activates the promoter of another EBV gene (BSLF2+BMLF1).
Subcellular Location
Host nucleus
Biologically active
Not Test
Protein length
Full Length

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close